From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001856
  • pan locus tag?: SAUPAN004793000
  • symbol: JSNZ_001856
  • pan gene symbol?: glnQ
  • synonym:
  • product: amino acid ABC transporter ATP-binding protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001856
  • symbol: JSNZ_001856
  • product: amino acid ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1893981..1894703
  • length: 723
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGATTAAAATAAACAATCTTAATAAAGTTTTTGGAGATAATGAAGTTTTAAAAGATATC
    AATCTTGAAATCAATCAAGGGGAAGTAGTAGCAATAATAGGTCCATCTGGTAGTGGTAAA
    AGTACATTGTTAAGATGTATGAATTTATTAGAAGTACCCACTAAAGGTCAAGTGATTTTT
    GAAGGCAATGACTTAACGGAAAAAGGGACACAAGTAGATAAACTACGTCAAAAAATGGGT
    ATGGTATTTCAAAACTTCAACCTATTTCCACATAAAAAAGTTGTCGATAATATTATTTTA
    GCTCCTAAATTATTAAAGAAAGATAATAACGATGAATTACATAAGGAAGCATTGTCGTTA
    TTAGATAAAGTGGGATTAAAAGAAAAAGCAGATGTATATCCGAATCAATTATCAGGTGGT
    CAAAAGCAAAGGGTAGCAATTGCAAGAGCTTTAGCAATGCATCCAGATGTTATTTTATTC
    GATGAACCAACTTCAGCATTAGATCCTGAGGTAGTTGGTGATGTATTAAAAGTAATGAAA
    GACCTAGCCAAAGAAGGTATGACCATGGTGGTTGTGACACATGAAATGGGATTTGCCAAA
    GATGTAAGTGACAAAGTTATATTTATGGCAGATGGCGTTGTCGTAGAGTCAGGCACACCA
    GTCGAAATATTTGAACAACCGCAACATGAAAGAACACAAAATTTCTTAGCAAGAGTATTA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    723

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_001856
  • symbol: JSNZ_001856
  • description: amino acid ABC transporter ATP-binding protein
  • length: 240
  • theoretical pI: 5.70084
  • theoretical MW: 26571.7
  • GRAVY: -0.132083

⊟Function[edit | edit source]

  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 292.8)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 273.3)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 234.4)
    and 78 more
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 227.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 219.1)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 218.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 215)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 199.6)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 198.6)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 195)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 194.9)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189.1)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189.1)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 184.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 182.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 173.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 162.3)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 161.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 158.4)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 156.9)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.5)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 149.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 149.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 148.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 145.7)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 145.2)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 144)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 138.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 136.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 134.1)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 132.9)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 132.1)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 128.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 124)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 122.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 119)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 114.9)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 114.6)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.6)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 111.4)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.3)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.3)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 109.1)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 107.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 104.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 98)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 93.2)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 92.7)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 90.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 83.9)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 83.9)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 76.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 57.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 56)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.1)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 48.6)
    rad50 (TIGR00606; HMM-score: 17)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)
    KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 14.1)
    Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 13)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 12.9)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.4)
    Cell structure Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.4)
    Cellular processes Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.4)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 141.1)
    and 34 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 48.7)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 44.4)
    ABC_ATPase; P-loop domain (PF09818; HMM-score: 28)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 26.2)
    AAA_23; AAA domain (PF13476; HMM-score: 23.1)
    nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 20.9)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.9)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 19.5)
    AAA_22; AAA domain (PF13401; HMM-score: 18.9)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.5)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.4)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 15.8)
    AAA_18; AAA domain (PF13238; HMM-score: 15.5)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 14.8)
    AAA_25; AAA domain (PF13481; HMM-score: 14.8)
    AAA_30; AAA domain (PF13604; HMM-score: 14.6)
    AAA_33; AAA domain (PF13671; HMM-score: 14.6)
    AAA_13; AAA domain (PF13166; HMM-score: 14.5)
    ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 14.5)
    SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 14.4)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.3)
    NADP_Rossmann (CL0063) Methyltransf_17; S-adenosyl-L-methionine methyltransferase (PF12692; HMM-score: 13.9)
    P-loop_NTPase (CL0023) Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 13.8)
    NACHT; NACHT domain (PF05729; HMM-score: 13.6)
    AAA_24; AAA domain (PF13479; HMM-score: 13.6)
    AAA_28; AAA domain (PF13521; HMM-score: 13.6)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.4)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.9)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.5)
    AAA_14; AAA domain (PF13173; HMM-score: 12.4)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.3)
    DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 12.1)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 11.7)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.1099
    • Cytoplasmic Membrane Score: 0.7704
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.1195
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006829
    • TAT(Tat/SPI): 0.000261
    • LIPO(Sec/SPII): 0.000465
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQVIFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEALSLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKVMKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLARVL

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: ArgR/AhrC (repression) regulon, CodY (repression) regulon
    ArgR/AhrC(TF)important in Arginine biosynthesis, Arginine degradation;  regulation predicted or transferred from N315 and NCTC 8325  [2]
    CodY(TF)important in Amino acid metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [2]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. ↑ 2.0 2.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_001856&oldid=107497"