Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001511
- pan locus tag?: SAUPAN004075000
- symbol: argR
- pan gene symbol?: argR
- synonym: ahrC
- product: transcriptional regulator ArgR
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001511
- symbol: argR
- product: transcriptional regulator ArgR
- replicon: chromosome
- strand: -
- coordinates: 1554996..1555448
- length: 453
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421GTGCCCAAAAAATCGGTTAGGCATATAAAAATTAGAGAAATTATTTCAAATGAACAGATA
GAGACACAAGATGAATTAGTTAAACGATTAAACGATTATGATTTAAATGTCACTCAAGCA
ACTGTTTCTCGTGATATTAAAGAACTACAACTTATTAAAGTACCTATACCTTCAGGTCAA
TATGTTTATAGTTTACCAAATGATAGAAAATTCCATCCTTTAGAAAAATTGGGACGTTAT
TTAATGGATTCCTTTGTTAATATAGATGGTACTGATAATTTACTTGTTCTAAAAACATTA
CCTGGTAATGCACAATCTATTGGAGCTATATTAGACCAAATCAATTGGGAAGAAGTACTA
GGCACAATTTGTGGTGATGATACTTGTTTAATTATTTGTCGAAGCAAAGAGGCAAGTGAT
GAAATCAAGTCAAGAATTTTCAATTTGTTATAA60
120
180
240
300
360
420
453
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001511
- symbol: ArgR
- description: transcriptional regulator ArgR
- length: 150
- theoretical pI: 5.28159
- theoretical MW: 17097.6
- GRAVY: -0.267333
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 169.8)Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 169.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) Arg_repressor; Arginine repressor, DNA binding domain (PF01316; HMM-score: 95)Arg_repressor_C (CL0738) Arg_repressor_C; Arginine repressor, C-terminal domain (PF02863; HMM-score: 93.3)and 2 moreHTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 16.9)HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 11.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Arginine
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9713
- Cytoplasmic Membrane Score: 0.0137
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0149
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003318
- TAT(Tat/SPI): 0.000875
- LIPO(Sec/SPII): 0.000397
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: ArgR/AhrC (repression) regulon
ArgR/AhrC (TF) important in Arginine biosynthesis, Arginine degradation; regulation predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026)
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)