Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01990
- pan locus tag?: SAUPAN004793000
- symbol: SAOUHSC_01990
- pan gene symbol?: glnQ
- synonym:
- product: amino acid ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01990
- symbol: SAOUHSC_01990
- product: amino acid ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1893345..1894073
- length: 729
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921873 NCBI
- RefSeq: YP_500487 NCBI
- BioCyc: G1I0R-1856 BioCyc
- MicrobesOnline: 1290409 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGCCAGTGATTAAAATAAACAATCTTAATAAAGTTTTTGGAGATAATGAAGTTTTAAAA
GATATCAATCTTGAAATCAATCAAGGGGAAGTAGTAGCAATAATAGGTCCATCTGGTAGT
GGTAAAAGTACATTGTTAAGATGTATGAATTTATTAGAAGTACCTACTAAAGGTCAAGTG
ATTTTTGAAGGCAATGACTTAACGGAAAAAGGGACACAAGTAGATAAACTACGTCAAAAA
ATGGGTATGGTATTTCAAAACTTCAACCTATTTCCACATAAAAAAGTTGTCGATAATATT
ATTTTAGCTCCTAAATTATTAAAGAAAGATAATAACGATGAATTACATAAGGAAGCATTG
TCGTTATTAGATAAAGTGGGATTAAAAGAAAAAGCAGATGTATATCCGAATCAATTATCA
GGTGGTCAAAAACAAAGGGTAGCAATTGCAAGAGCTTTAGCAATGCATCCAGATGTTATT
TTATTCGATGAACCAACTTCAGCATTAGATCCTGAGGTAGTTGGTGATGTATTAAAAGTA
ATGAAAGACCTAGCCAAAGAAGGTATGACCATGGTGGTTGTGACACATGAAATGGGATTT
GCCAAAGATGTAAGTGACAAAGTCATATTTATGGCAGATGGCGTTGTCGTAGAGTCAGGC
ACACCAGTCGAAATATTTGAACAACCGCAACATGAAAGAACACAAAATTTCTTAGCAAGA
GTATTATAA60
120
180
240
300
360
420
480
540
600
660
720
729
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01990
- symbol: SAOUHSC_01990
- description: amino acid ABC transporter ATP-binding protein
- length: 242
- theoretical pI: 5.70084
- theoretical MW: 26768
- GRAVY: -0.120248
⊟Function[edit | edit source]
- TIGRFAM: ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 292.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 273.3)and 79 moreD-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 232.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 226.2)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 220.1)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 218.9)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 215)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 199.6)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 197.3)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 195.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 194.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 185.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 182.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 173.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 162.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 161.2)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 158.3)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 156.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 149.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 149.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 148.3)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 145.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 145.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 143.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 138.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 137.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 133.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 132.9)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 132.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 128.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 125.1)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 123.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 119)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 115)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 114.9)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 111.5)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 108.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 106.8)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 106.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 98.1)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 94.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 93.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 92)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 83.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 83.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 76.2)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 57.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 56)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 48.6)rad50 (TIGR00606; HMM-score: 17)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 14)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 13.1)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 12.9)Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.7)Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.7)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.4)
- TheSEED :
- Arginine ABC transporter, ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 141)and 34 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 48.7)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 44.4)ABC_ATPase; P-loop domain (PF09818; HMM-score: 27.9)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 26.2)AAA_23; AAA domain (PF13476; HMM-score: 22.8)nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 20.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.9)AAA_15; AAA ATPase domain (PF13175; HMM-score: 19.4)AAA_22; AAA domain (PF13401; HMM-score: 18.9)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.5)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 15.8)AAA_18; AAA domain (PF13238; HMM-score: 15.5)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 14.8)AAA_25; AAA domain (PF13481; HMM-score: 14.7)AAA_30; AAA domain (PF13604; HMM-score: 14.6)AAA_33; AAA domain (PF13671; HMM-score: 14.6)AAA_13; AAA domain (PF13166; HMM-score: 14.5)ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 14.4)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.3)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 14.3)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 14)NADP_Rossmann (CL0063) Methyltransf_17; S-adenosyl-L-methionine methyltransferase (PF12692; HMM-score: 13.9)P-loop_NTPase (CL0023) NACHT; NACHT domain (PF05729; HMM-score: 13.6)AAA_28; AAA domain (PF13521; HMM-score: 13.6)AAA_24; AAA domain (PF13479; HMM-score: 13.5)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.4)NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.8)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.5)AAA_14; AAA domain (PF13173; HMM-score: 12.4)Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.2)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 12.1)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 11.7)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1011
- Cytoplasmic Membrane Score: 0.7884
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1104
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002863
- TAT(Tat/SPI): 0.000169
- LIPO(Sec/SPII): 0.000221
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQVIFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEALSLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKVMKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLARVL
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SAOUHSC_02496 (rplF) 50S ribosomal protein L6 [3] (data from MRSA252) SAOUHSC_01232 (rpsB) 30S ribosomal protein S2 [3] (data from MRSA252) SAOUHSC_02494 (rpsE) 30S ribosomal protein S5 [3] (data from MRSA252) SAOUHSC_02477 (rpsI) 30S ribosomal protein S9 [3] (data from MRSA252) SAOUHSC_00530 elongation factor Tu [3] (data from MRSA252) SAOUHSC_01806 pyruvate kinase [3] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: CodY* (repression) regulon, ArgR*/AhrC (repression) regulon
CodY* (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise ArgR*/AhrC (TF) important in Arginine biosynthesis, Arginine degradation; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 3.2 3.3 3.4 3.5 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
