From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001386
  • pan locus tag?: SAUPAN003817000
  • symbol: cspA
  • pan gene symbol?: msaB
  • synonym:
  • product: cold shock protein CspA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001386
  • symbol: cspA
  • product: cold shock protein CspA
  • replicon: chromosome
  • strand: -
  • coordinates: 1401721..1401921
  • length: 201
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAACAAGGTACAGTTAAATGGTTTAACGCTGAAAAAGGATTCGGCTTTATCGAAGTT
    GAAGGAGAAAATGACGTATTCGTACATTTTTCAGCAATTAACCAAGATGGTTACAAATCA
    TTAGAAGAAGGTCAAGCTGTTGAGTTTGAAGTAGTTGAAGGCGACCGCGGTCCACAAGCT
    GCAAACGTTGTTAAACTATAA
    60
    120
    180
    201

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_001386
  • symbol: CspA
  • description: cold shock protein CspA
  • length: 66
  • theoretical pI: 4.22595
  • theoretical MW: 7321.06
  • GRAVY: -0.369697

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)
    and 1 more
    Genetic information processing Transcription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 10.1)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 107.5)
    and 3 more
    OB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 20.3)
    S1; S1 RNA binding domain (PF00575; HMM-score: 18.3)
    S1CSD-TOTE-2; S1/CSD-like domain 2 of the TOTE conflict systems (PF22707; HMM-score: 17.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9997
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0003
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005783
    • TAT(Tat/SPI): 0.000379
    • LIPO(Sec/SPII): 0.000772
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQAANVVKL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]