From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000679
  • pan locus tag?: SAUPAN002597000
  • symbol: queD
  • pan gene symbol?: queD
  • synonym:
  • product: 6-carboxytetrahydropterin synthase QueD

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000679
  • symbol: queD
  • product: 6-carboxytetrahydropterin synthase QueD
  • replicon: chromosome
  • strand: -
  • coordinates: 712464..712883
  • length: 420
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTACAACAAATCTATCCTAGTACAACGCATCCATATCAATTCGAATTAAATAAAGAT
    TTTAATTTTTCGGCTGCACATCACATTCCGTGTGAAGAAGCAGGTATTTGTCAAAATGTC
    CATGGTCATACTTACTTTGTTAATTTAACAATTGTCGGTGATAAACTAGATGACACTGGC
    TTCTTAGTGAACTTTAGCCATTTGAAAAAGATGATACACGGTAAATTTGACCATCAACTG
    TTAAATAACTTACCTGCTTTTAAAAACAAAATCCCTTCAACTGAAATCGTAGCGGAAACA
    ATTTATCAAATTGTTAAAGAAAATTTGGCATCGCTCGAACACCAACCAAAATGTATTCAA
    GTATTTGTAAGAGAAACACCAACAAGTTATGTTGTATTTAGACCAAAGGAACAGGTGTAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000679
  • symbol: QueD
  • description: 6-carboxytetrahydropterin synthase QueD
  • length: 139
  • theoretical pI: 7.01376
  • theoretical MW: 16011.2
  • GRAVY: -0.274101

Function[edit | edit source]

  • reaction:
    EC 4.1.2.50?  ExPASy
    6-carboxytetrahydropterin synthase 7,8-dihydroneopterin 3'-triphosphate + H2O = 6-carboxy-5,6,7,8-tetrahydropterin + acetaldehyde + triphosphate
  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification 6-pyruvoyl tetrahydropterin synthase/QueD family protein (TIGR00039; HMM-score: 100.7)
    Genetic information processing Protein synthesis tRNA and rRNA base modification queuosine biosynthesis protein QueD (TIGR03367; HMM-score: 93.8)
    and 1 more
    6-pyruvoyl tetrahydropterin synthase-related domain (TIGR03112; HMM-score: 30.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    THBO-biosyn (CL0334) PTPS; 6-pyruvoyl tetrahydropterin synthase (PF01242; HMM-score: 113.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9943
    • Cytoplasmic Membrane Score: 0.002
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0035
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007616
    • TAT(Tat/SPI): 0.000436
    • LIPO(Sec/SPII): 0.00065
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSYVVFRPKEQV

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [2] [3] [4]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  3. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  4. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]