Jump to navigation
		Jump to search
		
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0680 [new locus tag: NWMN_RS03845 ]
- pan locus tag?: SAUPAN002597000
- symbol: NWMN_0680
- pan gene symbol?: queD
- synonym:
- product: 6-pyruvoyl tetrahydropterin synthase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0680 [new locus tag: NWMN_RS03845 ]
- symbol: NWMN_0680
- product: 6-pyruvoyl tetrahydropterin synthase
- replicon: chromosome
- strand: -
- coordinates: 761271..761690
- length: 420
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330389 NCBI
- RefSeq: YP_001331714 NCBI
- BioCyc:
- MicrobesOnline: 3706227 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301
 361ATGTTACAACAAATCTATCCTAGTACAACGCATCCATATCAATTCGAATTAAATAAAGAT
 TTTAATTTTTCGGCTGCACATCACATTCCATGTGAAGAAGCAGGTATTTGTCAAAATGTC
 CATGGTCATACTTACTTTGTTAATTTAACAATTGTCGGTGATAAACTAGATGACACTGGC
 TTCTTAGTGAACTTTAGCCATTTGAAAAAGATGATACACGGTAAATTTGACCATCAACTG
 TTAAATAACTTACCTGCTTTTAAAAACAAAATCCCTTCAACTGAAATCGTAGCGGAAACA
 ATTTATCAAATTGTTAAAGAAAATTTGGCATCGCTCGAACACCAACCAAAATGTATTCAA
 GTATTTGTAAGAGAAACACCAACAAGTTATGTCGTATTTAGACCAAAGGAACAGGTGTAA60
 120
 180
 240
 300
 360
 420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0680 [new locus tag: NWMN_RS03845 ]
- symbol: NWMN_0680
- description: 6-pyruvoyl tetrahydropterin synthase
- length: 139
- theoretical pI: 7.01376
- theoretical MW: 16011.2
- GRAVY: -0.274101
⊟Function[edit | edit source]
- reaction: EC 4.1.2.50 ExPASy6-carboxytetrahydropterin synthase 7,8-dihydroneopterin 3'-triphosphate + H2O = 6-carboxy-5,6,7,8-tetrahydropterin + acetaldehyde + triphosphate?
- TIGRFAM: Protein synthesis tRNA and rRNA base modification 6-pyruvoyl tetrahydropterin synthase/QueD family protein (TIGR00039; HMM-score: 100.7)Protein synthesis tRNA and rRNA base modification queuosine biosynthesis protein QueD (TIGR03367; HMM-score: 93.8)and 1 more6-pyruvoyl tetrahydropterin synthase-related domain (TIGR03112; HMM-score: 30.8)
- TheSEED  : - 6-carboxytetrahydropterin synthase (EC 4.1.2.50)
 
- PFAM: THBO-biosyn (CL0334) PTPS; 6-pyruvoyl tetrahydropterin synthase (PF01242; HMM-score: 113.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Zn2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.9943
- Cytoplasmic Membrane Score: 0.002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0035
 
- LocateP: Intracellular - Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.007616
- TAT(Tat/SPI): 0.000436
- LIPO(Sec/SPII): 0.00065
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSYVVFRPKEQV
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: PreQ1 riboswitch (transcription termination) regulon, SigB (activation) regulonPreQ1 riboswitch (RNA) important in Queuosine biosynthesis; transcription unit transferred from N315 data RegPrecise SigB (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [1] other strains 
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan  
 Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
 J Bacteriol: 2004, 186(13);4085-99
 [PubMed:15205410] [WorldCat.org] [DOI] (P p)