From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000288
  • pan locus tag?: SAUPAN001868000
  • symbol: mepR
  • pan gene symbol?: mepR
  • synonym:
  • product: multidrug efflux transporter transcriptional repressor MepR

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000288
  • symbol: mepR
  • product: multidrug efflux transporter transcriptional repressor MepR
  • replicon: chromosome
  • strand: +
  • coordinates: 324809..325228
  • length: 420
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCT
    GATCAAAAGTTAGAGCAATTTGATATTACAAATGAGCAAGGTCATACGTTAGGTTATCTT
    TATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
    GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTAT
    GTCGATGCACAAGATACGAGAAGAAAGAATATAGGGCTGACTACCTCTGGGATTAAACTC
    GTAGAAGCATTCACTTCGATATTTGATGAAATGGAACAAACACTCGTATCGCAGTTATCT
    GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA
    60
    120
    180
    240
    300
    360
    420

⊟Protein[edit | edit source]

Protein Data Bank: 5F6F
Protein Data Bank: 5FFX

⊟General[edit | edit source]

  • locus tag: JSNZ_000288
  • symbol: MepR
  • description: multidrug efflux transporter transcriptional repressor MepR
  • length: 139
  • theoretical pI: 6.26722
  • theoretical MW: 16172.2
  • GRAVY: -0.669784

⊟Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.9)
    and 5 more
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 22.8)
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 20.4)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.8)
    Signal transduction Regulatory functions DNA interactions aminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 13.6)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 47.5)
    and 25 more
    MarR; MarR family (PF01047; HMM-score: 37.6)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 29.7)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 21.9)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 21.6)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.8)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 19.4)
    HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 19.3)
    HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.2)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.1)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.1)
    DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15)
    Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 14.7)
    no clan defined DUF445; Protein of unknown function (DUF445) (PF04286; HMM-score: 14.7)
    HTH (CL0123) Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.4)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.3)
    DUF1670; Protein of unknown function (DUF1670) (PF07900; HMM-score: 14.3)
    B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 13.5)
    AAA_lid (CL0671) Vps4_C; Vps4 C terminal oligomerisation domain (PF09336; HMM-score: 13.5)
    HTH (CL0123) HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 13.5)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 13.1)
    no clan defined DUF6664; Family of unknown function (DUF6664) (PF20369; HMM-score: 13)
    HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.4)
    HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12.2)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9936
    • Cytoplasmic Membrane Score: 0.0038
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0022
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005476
    • TAT(Tat/SPI): 0.000487
    • LIPO(Sec/SPII): 0.000763
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: MepR (repression) regulon
    MepR(TF)important in Multidrug resistance;  regulation predicted or transferred from N315 and NCTC 8325  [2]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_000288&oldid=105929"