Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS06370 [old locus tag: EGJ38_001275 ]
- pan locus tag?: SAUPAN003619000
- symbol: hfq
- pan gene symbol?: hfq
- synonym:
- product: RNA chaperone Hfq
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS06370 [old locus tag: EGJ38_001275 ]
- symbol: hfq
- product: RNA chaperone Hfq
- replicon: chromosome
- strand: +
- coordinates: 1293245..1293478
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1293245..1293478) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTGCAAACGAAAACATCCAAGACAAAGCACTAGAGAATTTTAAAGCAAACCAAACT
GAAGTAACTGTATTCTTTCTAAACGGTTTCCAAATGAAAGGTGTTATTGAAGAATACGAC
AAGTATGTCGTAAGCTTAAATTCTCAAGGCAAACAACACTTGATTTACAAACATGCGATC
AGCACTTATACAGTAGAAACTGAAGGTCAAGCATCTACTGAAAGTGAAGAATAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS06370 [old locus tag: EGJ38_001275 ]
- symbol: Hfq
- description: RNA chaperone Hfq
- length: 77
- theoretical pI: 4.39044
- theoretical MW: 8778.67
- GRAVY: -0.544156
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions Other RNA chaperone Hfq (TIGR02383; HMM-score: 104.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: SH3 (CL0010) Hfq; Hfq protein (PF17209; HMM-score: 90.3)and 4 moreHfq_1; Hfq related (PF21979; HMM-score: 17.9)MBG (CL0682) MBG; MBG domain (PF17883; HMM-score: 14.7)no clan defined DUF4809; Domain of unknown function (DUF4809) (PF16067; HMM-score: 13.7)PRTase-like (CL0533) StiP; Tellurite-like stress resistance cysteine protease StiP (PF11202; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9622
- Cytoplasmic Membrane Score: 0.0067
- Cell wall & surface Score: 0.0026
- Extracellular Score: 0.0285
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003191
- TAT(Tat/SPI): 0.000423
- LIPO(Sec/SPII): 0.000661
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000561358 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTVETEGQASTESEE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]