From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS05620 [old locus tag: SA0992 ]
  • symbol: SA_RS05620
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: +
  • coordinates: 1124617..1124931
  • length: 315
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (1124617..1124931) NCBI
  • BioCyc: SA_RS05620 BioCyc
  • MicrobesOnline: see SA0992

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGCAATCGTAAAAGTAACAGATGCAGATTTTGATTCAAAAGTAGAATCTGGTGTACAA
    CTAGTAGATTTTTGGGCAACATGGTGTGGTCCATGTAAAATGATCGCTCCGGTATTAGAA
    GAATTAGCAGCTGACTATGAAGGTAAAGCTGACATTTTAAAATTAGATGTTGATGAAAAT
    CCATCAACTGCAGCTAAATATGAAGTGATGAGTATTCCAACATTAATCGTCTTTAAAGAC
    GGTCAACCAGTTGATAAAGTTGTTGGTTTCCAACCAAAAGAAAACTTAGCTGAAGTTTTA
    GATAAACATTTATAA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS05620 [old locus tag: SA0992 ]
  • symbol: SA_RS05620
  • description: thiol reductase thioredoxin
  • length: 104
  • theoretical pI: 4.14487
  • theoretical MW: 11440.1
  • GRAVY: 0.0288462

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 132.2)
    and 9 more
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 65.5)
    protein disulfide isomerase (TIGR01130; HMM-score: 56.6)
    Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 34.4)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 31.6)
    glutaredoxin-like domain protein (TIGR02187; HMM-score: 24.2)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 22.3)
    glutaredoxin-like protein (TIGR02200; HMM-score: 22.1)
    Metabolism Central intermediary metabolism Sulfur metabolism 5'-adenylylsulfate reductase, thioredoxin-independent (TIGR00424; HMM-score: 14.9)
    type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
  • TheSEED: see SA0992
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 115.4)
    and 13 more
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 37.9)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 33.4)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 24.8)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 23.7)
    AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 21.8)
    KaiB; KaiB domain (PF07689; HMM-score: 20.3)
    Redoxin; Redoxin (PF08534; HMM-score: 19.4)
    Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 19.1)
    OST3_OST6; OST3 / OST6 family, transporter family (PF04756; HMM-score: 18.4)
    TraF; F plasmid transfer operon protein (PF13728; HMM-score: 16.5)
    HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 16.1)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 13.8)
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9468
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0527
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.01275
    • TAT(Tat/SPI): 0.000543
    • LIPO(Sec/SPII): 0.001187
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAIVKVTDADFDSKVESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA_RS11130(deoA)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS02615pur operon repressor  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS02935DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS04140aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS04710hypothetical protein  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06295translation initiation factor IF-2  [1] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1163050S ribosomal protein L17  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)
    SA_RS1170550S ribosomal protein L5  [1] (data from MRSA252)
    SA_RS1172030S ribosomal protein S17  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Jump up to: 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS05620 [old locus tag: SA0992 ]
  • pan locus tag?: SAUPAN003383000
  • symbol: SA_RS05620
  • pan gene symbol?: trxA
  • synonym:
  • product: thiol reductase thioredoxin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS05620 [old locus tag: SA0992 ]
  • symbol: SA_RS05620
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: +
  • coordinates: 1124617..1124931
  • length: 315
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (1124617..1124931) NCBI
  • BioCyc: SA_RS05620 BioCyc
  • MicrobesOnline: see SA0992

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGCAATCGTAAAAGTAACAGATGCAGATTTTGATTCAAAAGTAGAATCTGGTGTACAA
    CTAGTAGATTTTTGGGCAACATGGTGTGGTCCATGTAAAATGATCGCTCCGGTATTAGAA
    GAATTAGCAGCTGACTATGAAGGTAAAGCTGACATTTTAAAATTAGATGTTGATGAAAAT
    CCATCAACTGCAGCTAAATATGAAGTGATGAGTATTCCAACATTAATCGTCTTTAAAGAC
    GGTCAACCAGTTGATAAAGTTGTTGGTTTCCAACCAAAAGAAAACTTAGCTGAAGTTTTA
    GATAAACATTTATAA
    60
    120
    180
    240
    300
    315

This data comes from external databases and cannot be edited.

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS05620 [old locus tag: SA0992 ]
  • symbol: SA_RS05620
  • description: thiol reductase thioredoxin
  • length: 104
  • theoretical pI: 4.14487
  • theoretical MW: 11440.1
  • GRAVY: 0.0288462

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 132.2)
    and 9 more
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 65.5)
    protein disulfide isomerase (TIGR01130; HMM-score: 56.6)
    Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 34.4)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 31.6)
    glutaredoxin-like domain protein (TIGR02187; HMM-score: 24.2)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 22.3)
    glutaredoxin-like protein (TIGR02200; HMM-score: 22.1)
    Metabolism Central intermediary metabolism Sulfur metabolism 5'-adenylylsulfate reductase, thioredoxin-independent (TIGR00424; HMM-score: 14.9)
    type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
  • TheSEED: see SA0992
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 115.4)
    and 13 more
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 37.9)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 33.4)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 24.8)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 23.7)
    AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 21.8)
    KaiB; KaiB domain (PF07689; HMM-score: 20.3)
    Redoxin; Redoxin (PF08534; HMM-score: 19.4)
    Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 19.1)
    OST3_OST6; OST3 / OST6 family, transporter family (PF04756; HMM-score: 18.4)
    TraF; F plasmid transfer operon protein (PF13728; HMM-score: 16.5)
    HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 16.1)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 13.8)
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9468
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0527
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.01275
    • TAT(Tat/SPI): 0.000543
    • LIPO(Sec/SPII): 0.001187
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAIVKVTDADFDSKVESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA_RS11130(deoA)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS02615pur operon repressor  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS02935DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS04140aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS04710hypothetical protein  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06295translation initiation factor IF-2  [1] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1163050S ribosomal protein L17  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)
    SA_RS1170550S ribosomal protein L5  [1] (data from MRSA252)
    SA_RS1172030S ribosomal protein S17  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Other Information[edit | edit source]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]