UndoCtrl+ZRedoCtrl+Shift+Z, Ctrl+Y
LinkCtrl+K

Links

Link important words to other wiki articles or even other websites. It will help readers understand the context.

Okay, got it
Special character
Edit notices
Save changes…Alt+S
ParagraphCtrl+0HeadingCtrl+2Sub-heading 1Ctrl+3Sub-heading 2Ctrl+4Sub-heading 3Ctrl+5Sub-heading 4Ctrl+6Header cellContent cellPreformattedCtrl+7Block quoteCtrl+8Page titleCtrl+1
BoldCtrl+BItalicCtrl+ISuperscriptCtrl+.SubscriptCtrl+,Computer codeCtrl+Shift+6StrikethroughCtrl+Shift+5UnderlineCtrl+UBigSmallLanguageRemoveCtrl+\, Ctrl+MMore
PubMedBasicCtrl+Shift+KRe-useMore
Bullet listNumbered listDecrease indentationShift+Tab, Ctrl+[Increase indentationTab, Ctrl+]More
Images and mediaTemplateTableCommentGalleryYour signatureReferences listMore
Read the user guideKeyboard shortcutsCtrl+/, Ctrl+Shift+/Toolbar searchCtrl+Shift+P, Ctrl+Alt+Shift+P
More
2 noticesClose
Warning: You are not logged in. Your IP address will be publicly visible if you make any edits. If you log in or create an account, your edits will be attributed to your username, along with other benefits.

You are using a browser which is not officially supported by this editor.

OptionsCategoriesPage settingsAdvanced settingsLanguagesTemplates used⧼visualeditor-changedir-rtl⧽Ctrl+Shift+XFind and replaceCtrl+FMore
Visual editingSource editingMore
From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04690 [old locus tag: SA0825 ]
  • pan locus tag?: SAUPAN003073000
  • symbol: SA_RS04690
  • pan gene symbol?: spsA
  • synonym:
  • product: inactive signal peptidase IA

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04690 [old locus tag: SA0825 ]
  • symbol: SA_RS04690
  • product: inactive signal peptidase IA
  • replicon: chromosome
  • strand: +
  • coordinates: 931102..931626
  • length: 525
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (931102..931626) NCBI
  • BioCyc: SA_RS04690 BioCyc
  • MicrobesOnline: see SA0825

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGAAAAAAGTTGTAAAATATTTGATTTCATTGATACTTGCTATTATCATTGTACTGTTC
    GTACAAACTTTTGTAATAGTTGGTCATGTCATTCCGAATAATGATATGTCACCAACCCTT
    AACAAAGGGGATCGTGTTATTGTAAATAAAATTAAAGTTACATTTAATCAATTGAATAAT
    GGTGATATCATTACATATAGGCGTGGTAACGAGATATATACTAGTCGAATTATTGCCAAA
    CCTGGTCAATCAATGGCGTTTCGTCAGGGACAATTATACCGTGATGACCGACCGGTTGAC
    GCATCTTATGCCAAGAACAGAAAAATTAAAGATTTTAGTTTGCGCAATTTTAAAGAATTA
    GATGGAGATATTATACCGCCTAACAATTTTGTTGTGCTAAATGATCATGATAACAATCAG
    CATGATTCTAGACAATTTGGTTTAATTGATAAAAAGGATATTATTGGTAATATAAGTTTG
    AGATATTATCCTTTTTCAAAATGGACGATTCAGTTCAAATCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    525

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS04690 [old locus tag: SA0825 ]
  • symbol: SA_RS04690
  • description: inactive signal peptidase IA
  • length: 174
  • theoretical pI: 10.3995
  • theoretical MW: 20146.2
  • GRAVY: -0.302874

⊟Function[edit | edit source]

  • ⊞⊞TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 150.7)
    and 4 more
    Cellular processes Cellular processes Detoxification nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 41)
    Genetic information processing Protein fate Protein modification and repair nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 41)
    conjugative transfer signal peptidase TraF (TIGR02771; HMM-score: 32.8)
    signal peptidase I (TIGR02228; EC 3.4.21.89; HMM-score: 28.7)
  • TheSEED: see SA0825
  • ⊞⊞PFAM:
    Peptidase_SF (CL0299) Peptidase_S26; Signal peptidase, peptidase S26 (PF10502; HMM-score: 113.3)
    and 5 more
    Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 19)
    no clan defined DUF2534; Protein of unknown function (DUF2534) (PF10749; HMM-score: 15.2)
    Neurensin; Neurensin/Transmembrane protein 74 (PF14927; HMM-score: 12.3)
    RBG (CL0760) AsmA; AsmA family (PF05170; HMM-score: 12.1)
    no clan defined E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 9.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞⊞PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.76
    • Extracellular Score: 0.7
    • Internal Helix: 1
  • ⊞⊞DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0007
    • Cytoplasmic Membrane Score: 0.9888
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0102
  • LocateP:
  • ⊞⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.473598
    • TAT(Tat/SPI): 0.000476
    • LIPO(Sec/SPII): 0.051893
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKKVVKYLISLILAIIIVLFVQTFVIVGHVIPNNDMSPTLNKGDRVIVNKIKVTFNQLNNGDIITYRRGNEIYTSRIIAKPGQSMAFRQGQLYRDDRPVDASYAKNRKIKDFSLRNFKELDGDIIPPNNFVVLNDHDNNQHDSRQFGLIDKKDIIGNISLRYYPFSKWTIQFKS

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • ⊟⊟interaction partners:
    SA_RS00690immunoglobulin G-binding protein A  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS01365L-lactate dehydrogenase  [1] (data from MRSA252)
    SA_RS02005GTP-binding protein YchF  [1] (data from MRSA252)
    SA_RS0201530S ribosomal protein S6  [1] (data from MRSA252)
    SA_RS02120hypothetical protein  [1] (data from MRSA252)
    SA_RS02145IMP dehydrogenase  [1] (data from MRSA252)
    SA_RS02490YbaB/EbfC family nucleoid-associated protein  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS0292050S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA_RS02930DNA-directed RNA polymerase subunit beta  [1] (data from MRSA252)
    SA_RS02935DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA_RS0295030S ribosomal protein S7  [1] (data from MRSA252)
    SA_RS041552,3-bisphosphoglycerate-independent phosphoglycerate mutase  [1] (data from MRSA252)
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS05190bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05355pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06235elongation factor Ts  [1] (data from MRSA252)
    SA_RS06490glutamine synthetase  [1] (data from MRSA252)
    SA_RS07060dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS08435trigger factor  [1] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [1] (data from MRSA252)
    SA_RS08545isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS0867530S ribosomal protein S4  [1] (data from MRSA252)
    SA_RS09810non-heme ferritin  [1] (data from MRSA252)
    SA_RS11070UDP-N-acetylglucosamine 1-carboxyvinyltransferase  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS11635DNA-directed RNA polymerase subunit alpha  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [1] (data from MRSA252)
    SA_RS1171050S ribosomal protein L24  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [1] (data from MRSA252)
    SA_RS13340pyruvate oxidase  [1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Jump up to: 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA_RS04690&oldid=78034"
Insert paragraph

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04690 [old locus tag: SA0825 ]
  • pan locus tag?: SAUPAN003073000
  • symbol: SA_RS04690
  • pan gene symbol?: spsA
  • synonym:
  • product: inactive signal peptidase IA

Insert paragraph

⊟Genome View[edit | edit source]

Insert paragraph

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04690 [old locus tag: SA0825 ]
  • symbol: SA_RS04690
  • product: inactive signal peptidase IA
  • replicon: chromosome
  • strand: +
  • coordinates: 931102..931626
  • length: 525
  • essential: no DEG other strains

Insert paragraph

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (931102..931626) NCBI
  • BioCyc: SA_RS04690 BioCyc
  • MicrobesOnline: see SA0825

Insert paragraph

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGAAAAAAGTTGTAAAATATTTGATTTCATTGATACTTGCTATTATCATTGTACTGTTC
    GTACAAACTTTTGTAATAGTTGGTCATGTCATTCCGAATAATGATATGTCACCAACCCTT
    AACAAAGGGGATCGTGTTATTGTAAATAAAATTAAAGTTACATTTAATCAATTGAATAAT
    GGTGATATCATTACATATAGGCGTGGTAACGAGATATATACTAGTCGAATTATTGCCAAA
    CCTGGTCAATCAATGGCGTTTCGTCAGGGACAATTATACCGTGATGACCGACCGGTTGAC
    GCATCTTATGCCAAGAACAGAAAAATTAAAGATTTTAGTTTGCGCAATTTTAAAGAATTA
    GATGGAGATATTATACCGCCTAACAATTTTGTTGTGCTAAATGATCATGATAACAATCAG
    CATGATTCTAGACAATTTGGTTTAATTGATAAAAAGGATATTATTGGTAATATAAGTTTG
    AGATATTATCCTTTTTCAAAATGGACGATTCAGTTCAAATCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    525

Insert paragraph

This data comes from external databases and cannot be edited.

Insert paragraph

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS04690 [old locus tag: SA0825 ]
  • symbol: SA_RS04690
  • description: inactive signal peptidase IA
  • length: 174
  • theoretical pI: 10.3995
  • theoretical MW: 20146.2
  • GRAVY: -0.302874

Insert paragraph

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 150.7)
    and 4 more
    Cellular processes Cellular processes Detoxification nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 41)
    Genetic information processing Protein fate Protein modification and repair nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 41)
    conjugative transfer signal peptidase TraF (TIGR02771; HMM-score: 32.8)
    signal peptidase I (TIGR02228; EC 3.4.21.89; HMM-score: 28.7)
  • TheSEED: see SA0825
  • ⊞PFAM:
    Peptidase_SF (CL0299) Peptidase_S26; Signal peptidase, peptidase S26 (PF10502; HMM-score: 113.3)
    and 5 more
    Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 19)
    no clan defined DUF2534; Protein of unknown function (DUF2534) (PF10749; HMM-score: 15.2)
    Neurensin; Neurensin/Transmembrane protein 74 (PF14927; HMM-score: 12.3)
    RBG (CL0760) AsmA; AsmA family (PF05170; HMM-score: 12.1)
    no clan defined E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 9.8)

Insert paragraph

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Insert paragraph

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.76
    • Extracellular Score: 0.7
    • Internal Helix: 1
  • ⊞DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0007
    • Cytoplasmic Membrane Score: 0.9888
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0102
  • LocateP:
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.473598
    • TAT(Tat/SPI): 0.000476
    • LIPO(Sec/SPII): 0.051893
  • predicted transmembrane helices (TMHMM): 1

Insert paragraph

⊟Accession numbers[edit | edit source]

Insert paragraph

⊟Protein sequence[edit | edit source]

  • MKKVVKYLISLILAIIIVLFVQTFVIVGHVIPNNDMSPTLNKGDRVIVNKIKVTFNQLNNGDIITYRRGNEIYTSRIIAKPGQSMAFRQGQLYRDDRPVDASYAKNRKIKDFSLRNFKELDGDIIPPNNFVVLNDHDNNQHDSRQFGLIDKKDIIGNISLRYYPFSKWTIQFKS

Insert paragraph

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • ⊟interaction partners:
    SA_RS00690immunoglobulin G-binding protein A  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS01365L-lactate dehydrogenase  [1] (data from MRSA252)
    SA_RS02005GTP-binding protein YchF  [1] (data from MRSA252)
    SA_RS0201530S ribosomal protein S6  [1] (data from MRSA252)
    SA_RS02120hypothetical protein  [1] (data from MRSA252)
    SA_RS02145IMP dehydrogenase  [1] (data from MRSA252)
    SA_RS02490YbaB/EbfC family nucleoid-associated protein  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS0292050S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA_RS02930DNA-directed RNA polymerase subunit beta  [1] (data from MRSA252)
    SA_RS02935DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA_RS0295030S ribosomal protein S7  [1] (data from MRSA252)
    SA_RS041552,3-bisphosphoglycerate-independent phosphoglycerate mutase  [1] (data from MRSA252)
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS05190bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05355pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06235elongation factor Ts  [1] (data from MRSA252)
    SA_RS06490glutamine synthetase  [1] (data from MRSA252)
    SA_RS07060dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS08435trigger factor  [1] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [1] (data from MRSA252)
    SA_RS08545isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS0867530S ribosomal protein S4  [1] (data from MRSA252)
    SA_RS09810non-heme ferritin  [1] (data from MRSA252)
    SA_RS11070UDP-N-acetylglucosamine 1-carboxyvinyltransferase  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS11635DNA-directed RNA polymerase subunit alpha  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [1] (data from MRSA252)
    SA_RS1171050S ribosomal protein L24  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [1] (data from MRSA252)
    SA_RS13340pyruvate oxidase  [1] (data from MRSA252)

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
Insert paragraph

⊟Expression & Regulation[edit | edit source]

Insert paragraph

⊟Operon[edit | edit source]

Insert paragraph

⊟Regulation[edit | edit source]

  • regulator:

Insert paragraph

⊟Transcription pattern[edit | edit source]

Insert paragraph

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

Insert paragraph

⊟Protein stability[edit | edit source]

  • half-life: no data available

Insert paragraph

⊞Biological Material[edit | edit source]

Insert paragraph

Insert paragraph

Insert paragraph

Insert paragraph

Insert paragraph

Insert paragraph

Insert paragraph

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

Insert paragraph

⊟Relevant publications[edit | edit source]

Insert paragraph