Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2030 [new locus tag: SA_RS11675 ]
- pan locus tag?: SAUPAN005684000
- symbol: rpmD
- pan gene symbol?: rpmD
- synonym:
- product: 50S ribosomal protein L30
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2030 [new locus tag: SA_RS11675 ]
- symbol: rpmD
- product: 50S ribosomal protein L30
- replicon: chromosome
- strand: -
- coordinates: 2299900..2300079
- length: 180
- essential: yes DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124950 NCBI
- RefSeq: NP_375345 NCBI
- BioCyc: see SA_RS11675
- MicrobesOnline: 104371 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGCTAAATTACAAATTACCCTCACTCGTAGTGTTATTGGTCGTCCTGAAACACAACGT
AAAACTGTTGAAGCTTTAGGTCTTAAAAAGACTAACAGTTCAGTAGTTGTTGAAGATAAC
CCTGCTATTCGTGGGCAAATCAACAAAGTTAAGCACTTAGTAACAGTAGAAGAAAAATAA60
120
180
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2030 [new locus tag: SA_RS11675 ]
- symbol: RpmD
- description: 50S ribosomal protein L30
- length: 59
- theoretical pI: 10.9014
- theoretical MW: 6553.63
- GRAVY: -0.4
⊟Function[edit | edit source]
- ⊞TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL30 (TIGR01308; HMM-score: 96)and 1 more
- TheSEED :
- LSU ribosomal protein L30p (L7e)
- PFAM: no clan defined Ribosomal_L30; Ribosomal protein L30p/L7e (PF00327; HMM-score: 83.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available