From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS09890 [old locus tag: SA1723 ]
  • pan locus tag?: SAUPAN004936000
  • symbol: SA_RS09890
  • pan gene symbol?: hisR
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS09890 [old locus tag: SA1723 ]
  • symbol: SA_RS09890
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1973555..1973857
  • length: 303
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (1973555..1973857) NCBI
  • BioCyc: SA_RS09890 BioCyc
  • MicrobesOnline: see SA1723

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAAATTGAAAAATTACGAGGTGCAGCGTTAGATGAATTGTTTGATGCAATACTAACG
    TTAGAAAATAGAGAAGAATGTTACCAATTTTTCGATGATTTGTGTACTGTAAATGAAATT
    CAATCACTGTCTCAAAGATTACAAGTTGCTAAAATGATTAAGCAAGGTTATACCTATGCA
    ACGATTGAACAAGAATCTGGAGCATCGACTGCAACGATTTCTAGAGTGAAACGTTCATTA
    CAATGGGGTAATGATGCTTATACAATGATTTTAGATCGTATGAATATTGAAACAAATGAA
    TAA
    60
    120
    180
    240
    300
    303

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS09890 [old locus tag: SA1723 ]
  • symbol: SA_RS09890
  • description: hypothetical protein
  • length: 100
  • theoretical pI: 4.27043
  • theoretical MW: 11518.9
  • GRAVY: -0.402

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 162.2)
    and 2 more
    Metabolism Amino acid biosynthesis Aromatic amino acid family trp operon repressor (TIGR01321; HMM-score: 20.8)
    Signal transduction Regulatory functions DNA interactions trp operon repressor (TIGR01321; HMM-score: 20.8)
  • TheSEED: see SA1723
  • ⊞PFAM:
    HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 122.9)
    and 5 more
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 21.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.4)
    RGS (CL0272) RGS; Regulator of G protein signaling domain (PF00615; HMM-score: 15)
    no clan defined DUF5338; Family of unknown function (DUF5338) (PF17273; HMM-score: 13.2)
    HTH (CL0123) HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 12.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by HisR*, TF important in Histidine biosynthesis: see SA1723

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9508
    • Cytoplasmic Membrane Score: 0.0332
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0157
  • LocateP:
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003872
    • TAT(Tat/SPI): 0.000703
    • LIPO(Sec/SPII): 0.000578
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA_RS09890&oldid=96142"