NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

organism: Staphylococcus aureus N315

locus tag: SA_RS06435 [old locus tag: SA1139 ]

pan locus tag^?: SAUPAN003609000

symbol: SA_RS06435

pan gene symbol^?: glpP

synonym:
product: glycerol-3-phosphate responsive antiterminator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

type: CDS
locus tag: SA_RS06435 [old locus tag: SA1139 ]
symbol: SA_RS06435
product: glycerol-3-phosphate responsive antiterminator
replicon: chromosome
strand: +
coordinates: 1295674..1296216
length: 543
essential: yes DEG other strains

⊟Accession numbers[edit | edit source]

Location: NC_002745 (1295674..1296216) NCBI
BioCyc: SA_RS06435 BioCyc
MicrobesOnline: see SA1139

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

1
61
121
181
241
301
361
421
481
541
ATGAATCAAGTGAATAACAACATATTGCCTGCTATAAGAAACATTAAAGATTTAGAGAAA
CTGATTAAAACAGATTATAAAATGTGTGTGCTTCTAGATATGCATATAGGACATATAAAA
AGTATTATGGAATTGCTGAAGCAAAATCATATAGAGTGTTTTATTCATATAGATTTGATA
AAAGGTTTAAGCCACGATGAATTTGCAAGTGAATTTATTATTCAGCAATACAAGCCAAAA
GGTATCGTATCGACTAAATCTAAAGTAATAAAAAAAGCTAAATCATTAAATACTTTAACG
ATTTTTAGAGTATTTATTATTGATAGTCAAGCATTGAAACGCAGTATAGATTTGATAAAA
AAAGTGGAACCTGATTTTGTTGAAGTACTTCCAGGTGTTGCGAGTAAAGCGATTCATCAT
ATTCAGAAAGAAACAAACACACAAGTCATTGCAGGTGGCCTAATTAATACAATAGATGAA
GTCAATGAAGCTGTTAAAAATGGAGCGAAATATGTAACAACTAGTTATGATAAACTTTGG
TAA
60
120
180
240
300
360
420
480
540
543

⊟Protein[edit | edit source]

⊟General[edit | edit source]

locus tag: SA_RS06435 [old locus tag: SA1139 ]
symbol: SA_RS06435
description: glycerol-3-phosphate responsive antiterminator
length: 180
theoretical pI: 9.59463
theoretical MW: 20449.9
GRAVY: -0.06

⊟Function[edit | edit source]

TIGRFAM:
Metabolism Amino acid biosynthesis Histidine family 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (TIGR00007; EC 5.3.1.16; HMM-score: 18.8)
Metabolism Amino acid biosynthesis Glutamate family 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TIGR01182; EC 4.1.2.14,4.1.3.16; HMM-score: 16.3)
Metabolism Energy metabolism Entner-Doudoroff 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TIGR01182; EC 4.1.2.14,4.1.3.16; HMM-score: 16.3)
TheSEED: see SA1139
⊞⊞PFAM:
TIM_barrel (CL0036) G3P_antiterm; Glycerol-3-phosphate responsive antiterminator (PF04309; HMM-score: 205.7)
and 1 more
His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 19.9)

⊟Structure, modifications & cofactors[edit | edit source]

domains:
modifications:
cofactors:
effectors:

⊟Localization[edit | edit source]

⊞⊞
PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
⊞⊞
DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9155
- Cytoplasmic Membrane Score: 0.0274
- Cell wall & surface Score: 0
- Extracellular Score: 0.0571
LocateP:
⊞⊞
SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000785
- TAT(Tat/SPI): 0.000073
- LIPO(Sec/SPII): 0.000133
predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

GI: 447000379 NCBI
RefSeq: WP_001077635 NCBI
UniProt: see SA1139

⊟Protein sequence[edit | edit source]

MNQVNNNILPAIRNIKDLEKLIKTDYKMCVLLDMHIGHIKSIMELLKQNHIECFIHIDLIKGLSHDEFASEFIIQQYKPKGIVSTKSKVIKKAKSLNTLTIFRVFIIDSQALKRSIDLIKKVEPDFVEVLPGVASKAIHHIQKETNTQVIAGGLINTIDEVNEAVKNGAKYVTTSYDKLW

⊟Experimental data[edit | edit source]

experimentally validated: data available for COL, NCTC8325
protein localization: data available for COL
quantitative data / protein copy number per cell: data available for COL

⊟⊟interaction partners:

SA_RS11130	(deoA)	pyrimidine-nucleoside phosphorylase ^[1] (data from MRSA252)
SA_RS09855	(gatA)	glutamyl-tRNA(Gln) amidotransferase subunit A ^[1] (data from MRSA252)
SA_RS00690		immunoglobulin G-binding protein A ^[1] (data from MRSA252)
SA_RS01275		formate acetyltransferase ^[1] (data from MRSA252)
SA_RS01365		L-lactate dehydrogenase ^[1] (data from MRSA252)
SA_RS02145		IMP dehydrogenase ^[1] (data from MRSA252)
SA_RS02810		pyridoxal 5'-phosphate synthase lyase subunit PdxS ^[1] (data from MRSA252)
SA_RS02905		50S ribosomal protein L11 ^[1] (data from MRSA252)
SA_RS02910		50S ribosomal protein L1 ^[1] (data from MRSA252)
SA_RS02915		50S ribosomal protein L10 ^[1] (data from MRSA252)
SA_RS02920		50S ribosomal protein L7/L12 ^[1] (data from MRSA252)
SA_RS02955		elongation factor G ^[1] (data from MRSA252)
SA_RS02960		elongation factor Tu ^[1] (data from MRSA252)
SA_RS03155		phosphate acetyltransferase ^[1] (data from MRSA252)
SA_RS03910		ribonucleotide-diphosphate reductase subunit alpha ^[1] (data from MRSA252)
SA_RS04020		ribosomal subunit interface protein ^[1] (data from MRSA252)
SA_RS04140		aldehyde dehydrogenase ^[1] (data from MRSA252)
SA_RS04160		enolase ^[1] (data from MRSA252)
SA_RS04575		NADH dehydrogenase ^[1] (data from MRSA252)
SA_RS04710		hypothetical protein ^[1] (data from MRSA252)
SA_RS05350		pyruvate dehydrogenase E1 component subunit alpha ^[1] (data from MRSA252)
SA_RS05355		pyruvate dehydrogenase E1 component subunit beta ^[1] (data from MRSA252)
SA_RS05360		dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex ^[1] (data from MRSA252)
SA_RS05365		dihydrolipoyl dehydrogenase ^[1] (data from MRSA252)
SA_RS05620		thiol reductase thioredoxin ^[1] (data from MRSA252)
SA_RS05860		cell division protein FtsZ ^[1] (data from MRSA252)
SA_RS06140		50S ribosomal protein L19 ^[1] (data from MRSA252)
SA_RS06225		30S ribosomal protein S2 ^[1] (data from MRSA252)
SA_RS06235		elongation factor Ts ^[1] (data from MRSA252)
SA_RS06730		aconitate hydratase ^[1] (data from MRSA252)
SA_RS07060		dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex ^[1] (data from MRSA252)
SA_RS07385		DNA-binding protein HU ^[1] (data from MRSA252)
SA_RS07955		molecular chaperone DnaK ^[1] (data from MRSA252)
SA_RS08295		50S ribosomal protein L21 ^[1] (data from MRSA252)
SA_RS08460		50S ribosomal protein L20 ^[1] (data from MRSA252)
SA_RS08505		aldehyde dehydrogenase ^[1] (data from MRSA252)
SA_RS08545		isocitrate dehydrogenase (NADP(+)) ^[1] (data from MRSA252)
SA_RS08560		pyruvate kinase ^[1] (data from MRSA252)
SA_RS08625		universal stress protein UspA ^[1] (data from MRSA252)
SA_RS08675		30S ribosomal protein S4 ^[1] (data from MRSA252)
SA_RS09055		S-adenosylmethionine synthase ^[1] (data from MRSA252)
SA_RS09810		non-heme ferritin ^[1] (data from MRSA252)
SA_RS11050		50S ribosomal protein L31 type B ^[1] (data from MRSA252)
SA_RS11245		glutamine--fructose-6-phosphate aminotransferase ^[1] (data from MRSA252)
SA_RS11430		Asp23/Gls24 family envelope stress response protein ^[1] (data from MRSA252)
SA_RS11600		30S ribosomal protein S9 ^[1] (data from MRSA252)
SA_RS11605		50S ribosomal protein L13 ^[1] (data from MRSA252)
SA_RS11645		30S ribosomal protein S13 ^[1] (data from MRSA252)
SA_RS11685		50S ribosomal protein L18 ^[1] (data from MRSA252)
SA_RS11690		50S ribosomal protein L6 ^[1] (data from MRSA252)
SA_RS11705		50S ribosomal protein L5 ^[1] (data from MRSA252)
SA_RS11720		30S ribosomal protein S17 ^[1] (data from MRSA252)
SA_RS11735		30S ribosomal protein S3 ^[1] (data from MRSA252)
SA_RS11745		30S ribosomal protein S19 ^[1] (data from MRSA252)
SA_RS11750		50S ribosomal protein L2 ^[1] (data from MRSA252)
SA_RS11760		50S ribosomal protein L4 ^[1] (data from MRSA252)
SA_RS13340		pyruvate oxidase ^[1] (data from MRSA252)
SA_RS13375		hydroxymethylglutaryl-CoA synthase ^[1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

regulator:

⊟Transcription pattern[edit | edit source]

S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

Aureolib: no data available

⊟Protein stability[edit | edit source]

half-life: no data available

⊞Biological Material[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

↑ ^{Jump up to: 1.00} ^1.01 ^1.02 ^1.03 ^1.04 ^1.05 ^1.06 ^1.07 ^1.08 ^1.09 ^1.10 ^1.11 ^1.12 ^1.13 ^1.14 ^1.15 ^1.16 ^1.17 ^1.18 ^1.19 ^1.20 ^1.21 ^1.22 ^1.23 ^1.24 ^1.25 ^1.26 ^1.27 ^1.28 ^1.29 ^1.30 ^1.31 ^1.32 ^1.33 ^1.34 ^1.35 ^1.36 ^1.37 ^1.38 ^1.39 ^1.40 ^1.41 ^1.42 ^1.43 ^1.44 ^1.45 ^1.46 ^1.47 ^1.48 ^1.49 ^1.50 ^1.51 ^1.52 ^1.53 ^1.54 ^1.55 ^1.56 ^1.57 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

[pubmed21166474-1] {Jump up to: 1.00} ^1.01 ^1.02 ^1.03 ^1.04 ^1.05 ^1.06 ^1.07 ^1.08 ^1.09 ^1.10 ^1.11 ^1.12 ^1.13 ^1.14 ^1.15 ^1.16 ^1.17 ^1.18 ^1.19 ^1.20 ^1.21 ^1.22 ^1.23 ^1.24 ^1.25 ^1.26 ^1.27 ^1.28 ^1.29 ^1.30 ^1.31 ^1.32 ^1.33 ^1.34 ^1.35 ^1.36 ^1.37 ^1.38 ^1.39 ^1.40 ^1.41 ^1.42 ^1.43 ^1.44 ^1.45 ^1.46 ^1.47 ^1.48 ^1.49 ^1.50 ^1.51 ^1.52 ^1.53 ^1.54 ^1.55 ^1.56 ^1.57 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)

[1]

Search

Navigation menu

Links

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]