Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0335 [new locus tag: SA_RS01920 ]
- pan locus tag?: SAUPAN001890000
- symbol: SA0335
- pan gene symbol?: tatA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0335 [new locus tag: SA_RS01920 ]
- symbol: SA0335
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 393696..393911
- length: 216
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123114 NCBI
- RefSeq: NP_373581 NCBI
- BioCyc: see SA_RS01920
- MicrobesOnline: 102607 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTCGTCATTAGC
ATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGTCGTGCTATCGGT
TCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGACAAAGAGTCTCACGACACA
CCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG60
120
180
216
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0335 [new locus tag: SA_RS01920 ]
- symbol: SA0335
- description: hypothetical protein
- length: 71
- theoretical pI: 9.23936
- theoretical MW: 7801.96
- GRAVY: -0.192958
⊟Function[edit | edit source]
- ⊞TIGRFAM: Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 68)and 1 more
- TheSEED :
- Twin-arginine translocation protein TatA
- ⊞PFAM: no clan defined TatA_B_E; mttA/Hcf106 family (PF02416; HMM-score: 71)and 1 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available