From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS06465 [old locus tag: SA1145 ]
  • symbol: SA_RS06465
  • product: RNA-binding protein Hfq
  • replicon: chromosome
  • strand: +
  • coordinates: 1302997..1303230
  • length: 234
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (1302997..1303230) NCBI
  • BioCyc: SA_RS06465 BioCyc
  • MicrobesOnline: see SA1145

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATTGCAAACGAAAACATCCAAGACAAAGCACTAGAGAATTTTAAAGCAAACCAAACT
    GAAGTAACTGTATTCTTTCTAAACGGTTTCCAAATGAAAGGTGTTATTGAAGAATACGAC
    AAGTATGTCGTAAGCTTAAATTCTCAAGGCAAACAACACTTGATTTACAAACATGCGATC
    AGCACTTATACAGTAGAAACTGAAGGTCAAGCATCTACTGAAAGTGAAGAATAA
    60
    120
    180
    234

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS06465 [old locus tag: SA1145 ]
  • symbol: SA_RS06465
  • description: RNA-binding protein Hfq
  • length: 77
  • theoretical pI: 4.39044
  • theoretical MW: 8778.67
  • GRAVY: -0.544156

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions Other RNA chaperone Hfq (TIGR02383; HMM-score: 104.1)
  • TheSEED: see SA1145
  • PFAM:
    SH3 (CL0010) Hfq; Hfq protein (PF17209; HMM-score: 90.3)
    and 4 more
    Hfq_1; Hfq related (PF21979; HMM-score: 17.9)
    MBG (CL0682) MBG; MBG domain (PF17883; HMM-score: 14.7)
    no clan defined DUF4809; Domain of unknown function (DUF4809) (PF16067; HMM-score: 13.7)
    PRTase-like (CL0533) StiP; Tellurite-like stress resistance cysteine protease StiP (PF11202; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9622
    • Cytoplasmic Membrane Score: 0.0067
    • Cell wall & surface Score: 0.0026
    • Extracellular Score: 0.0285
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003191
    • TAT(Tat/SPI): 0.000423
    • LIPO(Sec/SPII): 0.000661
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTVETEGQASTESEE

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]