PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Views

More

• Read
• Edit
• History
• Edit source

⊟Summary

• organism: Staphylococcus aureus N315
locus tag: SA1279 [new locus tag: SA_RS07245 ]
pan locus tag^?: SAUPAN003904000
symbol: SA1279
pan gene symbol^?: gpsB
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA1279 [new locus tag: SA_RS07245 ]
• symbol: SA1279
• product: hypothetical protein
• replicon: chromosome
• strand: -
• coordinates: 1484229..1484573
• length: 345
• essential: no DEG other strains

⊟Accession numbers

• Gene ID: 1124117 NCBI
• RefSeq: NP_374560 NCBI
• BioCyc: see SA_RS07245
• MicrobesOnline: 103586 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  
  ATGTCAGATGTTTCATTGAAATTATCAGCAAAAGATATTTATGAAAAAGATTTTGAAAAA
  ACGATGGCTCGTGGCTATAGAAGAGAAGAAGTAGATGCATTTTTAGATGACATTATTGCT
  GATTATCAAAAAATGGCCGATATGAATAATGAAGTTGTAAAATTATCAGAAGAGAATCAT
  AAACTTAAAAAAGAATTAGAAGAATTAAGACTACGTGTAGCAACATCAAGACCTCAGGAC
  AATAAAAGTTTTTCTTCGAATAATACAACAACAAATACATCTTCAAATAATGTAGATATT
  TTAAAACGTATTTCAAACTTAGAAAAAGCTGTATTTGGTAAATAA
  60
  120
  180
  240
  300
  345
  

⊟Protein

⊟General

• locus tag: SA1279 [new locus tag: SA_RS07245 ]
• symbol: SA1279
• description: hypothetical protein
• length: 114
• theoretical pI: 5.97468
• theoretical MW: 13150.7
• GRAVY: -0.867544

⊟Function

• ⊞TIGRFAM:
  DivIVA domain (TIGR03544; HMM-score: 52.8)
  and 4 more
  Cellular processes Cellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)
  Signal transduction Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)
  DivIVA domain repeat protein (TIGR03543; HMM-score: 16.1)
  SH3 domain protein (TIGR04211; HMM-score: 13.5)
• TheSEED  :
  • Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
  Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Control of cell elongation - division cycle in Bacilli  Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
• ⊞PFAM:
  no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 43.5)
  and 19 more
  YabA; Initiation control protein YabA (PF06156; HMM-score: 24.9)
  HMMR_C; Hyaluronan mediated motility receptor C-terminal (PF15908; HMM-score: 20)
  Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 18)
  bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 16.7)
  no clan defined DASH_Spc19; Spc19 (PF08287; HMM-score: 16.6)
  FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 16.5)
  Kre28-like_sf (CL0729) Sos7; Kinetochore protein Sos7 (PF20882; HMM-score: 16.3)
  no clan defined TssO; Type VI secretion system, TssO (PF17561; HMM-score: 15.6)
  HALZ; Homeobox associated leucine zipper (PF02183; HMM-score: 15)
  SlyX; SlyX (PF04102; HMM-score: 14.9)
  Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 14)
  no clan defined Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 13.9)
  TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 13.6)
  TMCO5; TMCO5 family (PF14992; HMM-score: 13.5)
  DUF2797; Protein of unknown function (DUF2797) (PF10977; HMM-score: 13.1)
  TPR (CL0020) FAN1_TPR; Fanconi-associated nuclease 1, TPR domain (PF21170; HMM-score: 13.1)
  no clan defined ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 12.1)
  bZIP (CL0018) bZIP_2; Basic region leucine zipper (PF07716; HMM-score: 11.4)
  no clan defined Herpes_BLRF2; Herpesvirus BLRF2 protein (PF05812; HMM-score: 11.3)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• ⊞PSORTb: Cytoplasmic
  • Cytoplasmic Score: 7.5
  • Cytoplasmic Membrane Score: 1.15
  • Cellwall Score: 0.62
  • Extracellular Score: 0.73
  • Internal Helices: 0
• ⊞DeepLocPro: Cytoplasmic
  • Cytoplasmic Score: 0.9708
  • Cytoplasmic Membrane Score: 0.0155
  • Cell wall & surface Score: 0.0027
  • Extracellular Score: 0.011
• ⊞LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• ⊞SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.001477
  • TAT(Tat/SPI): 0.000385
  • LIPO(Sec/SPII): 0.000377
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 15927027 NCBI
• RefSeq: NP_374560 NCBI
• UniProt: Q7A5L1 UniProt

⊟Protein sequence

• MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SA1279 < SA1280 < SA1281

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊞Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊞Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications