Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01462
- pan locus tag?: SAUPAN003904000
- symbol: SAOUHSC_01462
- pan gene symbol?: gpsB
- synonym: JSNZ_001430
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID: 3919904 NCBI
- RefSeq: YP_499980 NCBI
- BioCyc: G1I0R-1356 BioCyc
- MicrobesOnline: 1289894 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCAGATGTTTCATTGAAATTATCAGCAAAAGATATTTATGAAAAAGATTTTGAAAAA
ACGATGGCTCGTGGCTATAGAAGAGAAGAAGTAGATGCATTTTTAGATGACATTATTGCT
GATTATCAAAAAATGGCCGATATGAATAATGAAGTTGTAAAATTATCAGAAGAGAATCAT
AAACTTAAAAAAGAATTAGAAGAATTAAGACTACGTGTAGCAACATCAAGACCTCAGGAC
AATAAAAGTTTTTCTTCGAATAATACAACAACAAATACATCTTCAAATAATGTAGATATT
TTAAAACGTATTTCAAACTTAGAAAAAGCTGTATTTGGTAAATAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01462
- symbol: SAOUHSC_01462
- description: hypothetical protein
- length: 114
- theoretical pI: 5.97468
- theoretical MW: 13150.7
- GRAVY: -0.867544
⊟Function[edit | edit source]
- TIGRFAM: DivIVA domain (TIGR03544; HMM-score: 52.8)and 4 moreCellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)DivIVA domain repeat protein (TIGR03543; HMM-score: 16.1)SH3 domain protein (TIGR04211; HMM-score: 13.5)
- TheSEED :
- Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
- PFAM: no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 43.5)and 19 moreYabA; Initiation control protein YabA (PF06156; HMM-score: 24.9)HMMR_C; Hyaluronan mediated motility receptor C-terminal (PF15908; HMM-score: 20)Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 18)bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 16.7)no clan defined DASH_Spc19; Spc19 (PF08287; HMM-score: 16.6)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 16.5)Kre28-like_sf (CL0729) Sos7; Kinetochore protein Sos7 (PF20882; HMM-score: 16.3)no clan defined TssO; Type VI secretion system, TssO (PF17561; HMM-score: 15.6)HALZ; Homeobox associated leucine zipper (PF02183; HMM-score: 15)SlyX; SlyX (PF04102; HMM-score: 14.9)Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 14)no clan defined Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 13.9)TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 13.6)TMCO5; TMCO5 family (PF14992; HMM-score: 13.5)DUF2797; Protein of unknown function (DUF2797) (PF10977; HMM-score: 13.1)TPR (CL0020) FAN1_TPR; Fanconi-associated nuclease 1, TPR domain (PF21170; HMM-score: 13.1)no clan defined ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 12.1)bZIP (CL0018) bZIP_2; Basic region leucine zipper (PF07716; HMM-score: 11.4)no clan defined Herpes_BLRF2; Herpesvirus BLRF2 protein (PF05812; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9708
- Cytoplasmic Membrane Score: 0.0155
- Cell wall & surface Score: 0.0027
- Extracellular Score: 0.011
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001477
- TAT(Tat/SPI): 0.000385
- LIPO(Sec/SPII): 0.000377
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_01462 < SAOUHSC_01463 < SAOUHSC_01464predicted SigA promoter [4] : SAOUHSC_01459 < S609 < SAOUHSC_01460 < S610 < RnpB < SAOUHSC_01462 < SAOUHSC_01463 < SAOUHSC_01464
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
