NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

organism: Staphylococcus aureus Newman

locus tag: NWMN_1729 [new locus tag: NWMN_RS09750 ]

pan locus tag^?: SAUPAN004763000

symbol: NWMN_1729

pan gene symbol^?: hit

synonym:
product: Hit-family protein involved in cell-cycle regulation

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

type: CDS
locus tag: NWMN_1729 [new locus tag: NWMN_RS09750 ]
symbol: NWMN_1729
product: Hit-family protein involved in cell-cycle regulation
replicon: chromosome
strand: +
coordinates: 1929674..1930096
length: 423
essential: unknown other strains

⊟Accession numbers[edit | edit source]

Gene ID: 5331019 NCBI
RefSeq: YP_001332763 NCBI
BioCyc:
MicrobesOnline: 3707289 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

1
61
121
181
241
301
361
421
ATGTCAGAAACAATTTTCGGCAAAATTTTAACTGGAGAAATTCCTAGCTTTAAAGTATAT
GAAGACGATTATGTCTATGCCTTTTTAGATATATCACAAGTTACTAAAGGACATACGTTA
TTAATTCCTAAAAAAGCTTCTGCTAATATCTTTGAAACTGATGAAGAAACAATGAAACAT
ATCGGTGCAGCATTACCTAAAGTAGCAAATGCTATTAAGCGTGCATTTAATCCTGATGGT
TTAAACATTATTCAAAATAATGGTGAGTTTGCAGATCAATCTGTATTTCATATTCATTTC
CACTTAATTCCTCGATACGAAAATGATATTGATGGATTTGGTTATAAGTGGGAAACACAT
GAAGACATTTTAGATAACGATGCAAAACAACAAATTGCTGAACAAATTCAAGCACAATTT
TAA
60
120
180
240
300
360
420
423

⊟Protein[edit | edit source]

⊟General[edit | edit source]

locus tag: NWMN_1729 [new locus tag: NWMN_RS09750 ]
symbol: NWMN_1729
description: Hit-family protein involved in cell-cycle regulation
length: 140
theoretical pI: 4.65977
theoretical MW: 15944.8
GRAVY: -0.363571

⊟Function[edit | edit source]

TIGRFAM:
TheSEED :
- Histidine triad (HIT) nucleotide-binding protein, similarity with At5g48545 and yeast YDL125C (HNT1)
⊞⊞PFAM:
HIT (CL0265) HIT; HIT domain (PF01230; HMM-score: 95.9)
and 2 more
DcpS_C; Scavenger mRNA decapping enzyme C-term binding (PF11969; HMM-score: 42.7)
CwfJ_C_1; Protein similar to CwfJ C-terminus 1 (PF04677; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

domains:
modifications:
cofactors:
effectors:

⊟Localization[edit | edit source]

⊞⊞
PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
⊞⊞
DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9946
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0043
⊞⊞
LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
⊞⊞
SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002902
- TAT(Tat/SPI): 0.000496
- LIPO(Sec/SPII): 0.000222
predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

GI: 151221941 NCBI
RefSeq: YP_001332763 NCBI
UniProt: A0A0H3K8Y9 UniProt

⊟Protein sequence[edit | edit source]

MSETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIPKKASANIFETDEETMKHIGAALPKVANAIKRAFNPDGLNIIQNNGEFADQSVFHIHFHLIPRYENDIDGFGYKWETHEDILDNDAKQQIAEQIQAQF

⊟Experimental data[edit | edit source]

experimentally validated: data available for COL, NCTC8325
protein localization: data available for COL
quantitative data / protein copy number per cell: data available for COL

⊟⊟interaction partners:

NWMN_1142	(acpP)	acyl carrier protein ^[1] (data from MRSA252)
NWMN_1483	(dnaK)	molecular chaperone DnaK ^[1] (data from MRSA252)
NWMN_1169	(frr)	ribosome recycling factor ^[1] (data from MRSA252)
NWMN_0509	(fus)	elongation factor G ^[1] (data from MRSA252)
NWMN_1838	(gatA)	aspartyl/glutamyl-tRNA amidotransferase subunit A ^[1] (data from MRSA252)
NWMN_1837	(gatB)	aspartyl/glutamyl-tRNA amidotransferase subunit B ^[1] (data from MRSA252)
NWMN_1217	(glnA)	glutamine synthetase ^[1] (data from MRSA252)
NWMN_0961	(pdhC)	branched-chain alpha-keto acid dehydrogenase subunit E2 ^[1] (data from MRSA252)
NWMN_0962	(pdhD)	dihydrolipoamide dehydrogenase ^[1] (data from MRSA252)
NWMN_0959	(phdA)	pyruvate dehydrogenase E1 component, alpha subunit ^[1] (data from MRSA252)
NWMN_0960	(phdB)	pyruvate dehydrogenase E1 component, beta subunit ^[1] (data from MRSA252)
NWMN_1592	(pykA)	pyruvate kinase ^[1] (data from MRSA252)
NWMN_2149	(rplB)	50S ribosomal protein L2 ^[1] (data from MRSA252)
NWMN_2152	(rplC)	50S ribosomal protein L3 ^[1] (data from MRSA252)
NWMN_2151	(rplD)	50S ribosomal protein L4 ^[1] (data from MRSA252)
NWMN_2137	(rplF)	50S ribosomal protein L6 ^[1] (data from MRSA252)
NWMN_0501	(rplJ)	50S ribosomal protein L10 ^[1] (data from MRSA252)
NWMN_2133	(rplO)	50S ribosomal protein L15 ^[1] (data from MRSA252)
NWMN_2145	(rplP)	50S ribosomal protein L16 ^[1] (data from MRSA252)
NWMN_2136	(rplR)	50S ribosomal protein L18 ^[1] (data from MRSA252)
NWMN_1151	(rplS)	50S ribosomal protein L19 ^[1] (data from MRSA252)
NWMN_1549	(rplU)	50S ribosomal protein L21 ^[1] (data from MRSA252)
NWMN_2147	(rplV)	50S ribosomal protein L22 ^[1] (data from MRSA252)
NWMN_2146	(rpsC)	30S ribosomal protein S3 ^[1] (data from MRSA252)
NWMN_2135	(rpsE)	30S ribosomal protein S5 ^[1] (data from MRSA252)
NWMN_0357	(rpsF)	30S ribosomal protein S6 ^[1] (data from MRSA252)
NWMN_2138	(rpsH)	30S ribosomal protein S8 ^[1] (data from MRSA252)
NWMN_2127	(rpsK)	30S ribosomal protein S11 ^[1] (data from MRSA252)
NWMN_1182	(rpsO)	30S ribosomal protein S15 ^[1] (data from MRSA252)
NWMN_2143	(rpsQ)	30S ribosomal protein S17 ^[1] (data from MRSA252)
NWMN_2148	(rpsS)	30S ribosomal protein S19 ^[1] (data from MRSA252)
NWMN_1488	(rpsT)	30S ribosomal protein S20 ^[1] (data from MRSA252)
NWMN_0055	(spa)	immunoglobulin G binding protein A precursor (protein A) ^[1] (data from MRSA252)
NWMN_1326	(sucA)	2-oxoglutarate dehydrogenase E1 component ^[1] (data from MRSA252)
NWMN_1325	(sucB)	dihydrolipoamide succinyltransferase ^[1] (data from MRSA252)
NWMN_1155	(sucC)	succinyl-CoA synthetase subunit beta ^[1] (data from MRSA252)
NWMN_1569	(tig)	trigger factor ^[1] (data from MRSA252)
NWMN_1254	(tkt)	transketolase ^[1] (data from MRSA252)
NWMN_1607	(tpx)	thiol peroxidase ^[1] (data from MRSA252)
NWMN_1057	(trxA)	thioredoxin ^[1] (data from MRSA252)
NWMN_0510	(tufA)	elongation factor Tu ^[1] (data from MRSA252)
NWMN_0249		5'-nucleotidase, lipoprotein e(P4) family protein ^[1] (data from MRSA252)
NWMN_0475		cysteine synthase-like protein ^[1] (data from MRSA252)
NWMN_0533		hypothetical protein ^[1] (data from MRSA252)
NWMN_0641		hypothetical protein ^[1] (data from MRSA252)
NWMN_0811		hypothetical protein ^[1] (data from MRSA252)
NWMN_0885		hypothetical protein ^[1] (data from MRSA252)
NWMN_0949		phosphocarrier protein HPr ^[1] (data from MRSA252)
NWMN_0950		phosphoenolpyruvate-protein phosphatase ^[1] (data from MRSA252)
NWMN_1382		DNA-binding protein HU ^[1] (data from MRSA252)
NWMN_1600		universal stress protein family protein ^[1] (data from MRSA252)
NWMN_1604		universal stress protein family protein ^[1] (data from MRSA252)
NWMN_1737		hypothetical protein ^[1] (data from MRSA252)
NWMN_2043		hypothetical protein ^[1] (data from MRSA252)
NWMN_2086		alkaline shock protein 23 ^[1] (data from MRSA252)
NWMN_2503		fructose-1,6-bisphosphate aldolase ^[1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

MicrobesOnline: no polycistronic organisation predicted

⊟Regulation[edit | edit source]

regulator:

⊟Transcription pattern[edit | edit source]

S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

Aureolib: data available for COL

⊟Protein stability[edit | edit source]

half-life: no data available

⊞Biological Material[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

↑ ^{Jump up to: 1.00} ^1.01 ^1.02 ^1.03 ^1.04 ^1.05 ^1.06 ^1.07 ^1.08 ^1.09 ^1.10 ^1.11 ^1.12 ^1.13 ^1.14 ^1.15 ^1.16 ^1.17 ^1.18 ^1.19 ^1.20 ^1.21 ^1.22 ^1.23 ^1.24 ^1.25 ^1.26 ^1.27 ^1.28 ^1.29 ^1.30 ^1.31 ^1.32 ^1.33 ^1.34 ^1.35 ^1.36 ^1.37 ^1.38 ^1.39 ^1.40 ^1.41 ^1.42 ^1.43 ^1.44 ^1.45 ^1.46 ^1.47 ^1.48 ^1.49 ^1.50 ^1.51 ^1.52 ^1.53 ^1.54 ^1.55 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

[pubmed21166474-1] {Jump up to: 1.00} ^1.01 ^1.02 ^1.03 ^1.04 ^1.05 ^1.06 ^1.07 ^1.08 ^1.09 ^1.10 ^1.11 ^1.12 ^1.13 ^1.14 ^1.15 ^1.16 ^1.17 ^1.18 ^1.19 ^1.20 ^1.21 ^1.22 ^1.23 ^1.24 ^1.25 ^1.26 ^1.27 ^1.28 ^1.29 ^1.30 ^1.31 ^1.32 ^1.33 ^1.34 ^1.35 ^1.36 ^1.37 ^1.38 ^1.39 ^1.40 ^1.41 ^1.42 ^1.43 ^1.44 ^1.45 ^1.46 ^1.47 ^1.48 ^1.49 ^1.50 ^1.51 ^1.52 ^1.53 ^1.54 ^1.55 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)

[1]

Search

Navigation menu

Links

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]