⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0055 [new locus tag: NWMN_RS00315 ]
- pan locus tag?: SAUPAN000909000
- symbol: spa
- pan gene symbol?: spa
- synonym:
- product: immunoglobulin G binding protein A precursor (protein A)
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0055 [new locus tag: NWMN_RS00315 ]
- symbol: spa
- product: immunoglobulin G binding protein A precursor (protein A)
- replicon: chromosome
- strand: -
- coordinates: 73428..74990
- length: 1563
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332074 NCBI
- RefSeq: YP_001331090 NCBI
- BioCyc:
- MicrobesOnline: 3705586 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561ATGATGACTTTACAAATACATACAGGGGGTATTAATTTGAAAAAGAAAAACATTTATTCA
ATTCGTAAACTAGGTGTAGGTATTGCATCTGTAACTTTAGGTACATTACTTATATCTGGT
GGCGTAACACCTGCTGCAAATGCTGCGCAACACGATGAAGCTCAACAAAATGCTTTTTAT
CAAGTCTTAAATATGCCTAACTTAAATGCTGATCAACGCAATGGTTTTATCCAAAGCCTT
AAAGATGATCCAAGCCAAAGTGCTAACGTTTTAGGTGAAGCTCAAAAACTTAATGACTCT
CAAGCTCCAAAAGCTGATGCGCAACAAAATAACTTCAACAAAGATCAACAAAGCGCCTTC
TATGAAATCTTGAACATGCCTAACTTAAACGAAGCGCAACGTAACGGCTTCATTCAAAGT
CTTAAAGACGACCCAAGCCAAAGCACTAACGTTTTAGGTGAAGCTAAAAAATTAAACGAA
TCTCAAGCACCGAAAGCTGATAACAATTTCAACAAAGAACAACAAAATGCTTTCTATGAA
ATCTTGAATATGCCTAACTTAAACGAAGAACAACGCAATGGTTTCATCCAAAGCTTAAAA
GATGACCCAAGCCAAAGTGCTAACCTATTGTCAGAAGCTAAAAAGTTAAATGAATCTCAA
GCACCGAAAGCGGATAACAAATTCAACAAAGAACAACAAAATGCTTTCTATGAAATCTTA
CATTTACCTAACTTAAACGAAGAACAACGCAATGGTTTCATCCAAAGCCTAAAAGATGAC
CCAAGCCAAAGCGCTAACCTTTTAGCAGAAGCTAAAAAGCTAAATGATGCTCAAGCACCA
AAAGCTGACAACAAATTCAACAAAGAACAACAAAATGCTTTCTATGAAATTTTACATTTA
CCTAACTTAACTGAAGAACAACGTAACGGCTTCATCCAAAGCCTTAAAGACGATCCTTCA
GTGAGCAAAGAAATTTTAGCAGAAGCTAAAAAGCTAAACGATGCTCAAGCACCAAAAGAG
GAAGACAATAACAAGCCTGGCAAAGAAGACAATAACAAGCCTGGCAAAGAAGACAACAAC
AAGCCTGGTAAAGAAGACAACAACAAGCCTGGCAAAGAAGACGGCAACAAGCCTGGTAAA
GAAGACAACAAAAAACCTGGTAAAGAAGATGGCAACAAGCCTGGTAAAGAAGACAACAAA
AAACCTGGTAAAGAAGACGGCAACAAGCCTGGCAAAGAAGATGGCAACAAACCTGGTAAA
GAAGATGGTAACGGAGTACATGTCGTTAAACCTGGTGATACAGTAAATGACATTGCAAAA
GCAAACGGCACTACTGCTGACAAAATTGCTGCAGATAACAAATTAGCTGATAAAAACATG
ATCAAACCTGGTCAAGAACTTGTTGTTGATAAGAAGCAACCAGCAAACCATGCAGATGCT
AACAAAGCTCAAGCATTACCAGAAACTGGTGAAGAAAATCCATTCATCGGTACAACTGTA
TTTGGTGGATTATCATTAGCCTTAGGTGCAGCGTTATTAGCTGGACGTCGTCGCGAACTA
TAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1440
1500
1560
1563
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0055 [new locus tag: NWMN_RS00315 ]
- symbol: Spa
- description: immunoglobulin G binding protein A precursor (protein A)
- length: 520
- theoretical pI: 5.48928
- theoretical MW: 56833.4
- GRAVY: -1.09654
⊟Function[edit | edit source]
- TIGRFAM: gram-positive signal peptide, YSIRK family (TIGR01168; HMM-score: 34.3)and 3 moreCell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 19.4)Cellular processes Sporulation and germination spore coat assembly protein SafA (TIGR02899; HMM-score: 17.5)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs bacillithiol biosynthesis deacetylase BshB2 (TIGR04000; EC 3.-.-.-; HMM-score: 8.7)
- TheSEED :
- Protein A, von Willebrand factor binding protein Spa
- PFAM: B_GA (CL0598) B; B domain (PF02216; HMM-score: 474.6)and 21 moreGA; GA module (PF01468; HMM-score: 81.2)LysM (CL0187) LysM; LysM domain (PF01476; HMM-score: 50.2)no clan defined YSIRK_signal; YSIRK type signal peptide (PF04650; HMM-score: 39.8)Gram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 31.8)UFL1; E3 UFM1-protein ligase 1-like domain (PF23659; HMM-score: 31.7)Octapeptide; Octapeptide repeat (PF03373; HMM-score: 29.1)VBS-like (CL0705) Talin_IBS2B; Talin IBS2B domain (PF21896; HMM-score: 22.4)Acetyltrans (CL0257) HAT1_C; Histone acetyltransferase type B catalytic subunit, C-terminal (PF21183; HMM-score: 21.2)no clan defined IFT43; Intraflagellar transport protein 43 (PF15305; HMM-score: 18.6)TerB (CL0414) TerB; Tellurite resistance protein TerB (PF05099; HMM-score: 16.9)no clan defined MRP-63; Mitochondrial ribosome protein 63 (PF14978; HMM-score: 16.9)Dim_A_B_barrel (CL0032) DUF3291; Domain of unknown function (DUF3291) (PF11695; HMM-score: 16.7)no clan defined CLAMP; Flagellar C1a complex subunit C1a-32 (PF14769; HMM-score: 15.5)SNARE-fusion (CL0445) V-SNARE; Vesicle transport v-SNARE protein N-terminus (PF05008; HMM-score: 15.3)LysM (CL0187) LysM3_LYK4_5; LYK4/5 LysM3 domain (PF23473; HMM-score: 14.4)E-set (CL0159) GH85_C; GH85 endohexosaminidases, C-terminal domain (PF21910; HMM-score: 13.2)post-AAA (CL0604) DNApol3-delta_C; DNA polymerase III, delta subunit, C terminal (PF09115; HMM-score: 10)no clan defined NTS_2; N-terminal segments of P. falciparum erythrocyte membrane protein (PF15448; HMM-score: 9.5)ANIS5_cation-bd; SXP/RAL-2 family protein Ani s 5-like, metal-binding domain (PF02520; HMM-score: 9.1)MMgT; Membrane magnesium transporter (PF10270; HMM-score: 8.3)Met_repress (CL0057) DUF1778; Protein of unknown function (DUF1778) (PF08681; HMM-score: 6.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cellwall
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 9.98
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cell wall & surface
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.0424
- Cell wall & surface Score: 0.8982
- Extracellular Score: 0.0592
- LocateP: LPxTG Cell-wall anchored
- Prediction by SwissProt Classification: Cell Wall
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: found LPxTG motif :LPETG
- SignalP: Signal peptide SP(Sec/SPI) length 48 aa
- SP(Sec/SPI): 0.898915
- TAT(Tat/SPI): 0.082569
- LIPO(Sec/SPII): 0.003505
- Cleavage Site: CS pos: 48-49. ANA-AQ. Pr: 0.9236
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMTLQIHTGGINLKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CcpA regulon
CcpA (TF) important in Carbon catabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Andrea C DeDent, Molly McAdow, Olaf Schneewind
Distribution of protein A on the surface of Staphylococcus aureus.
J Bacteriol: 2007, 189(12);4473-84
[PubMed:17416657] [WorldCat.org] [DOI] (P p)Hwan Keun Kim, Vilasack Thammavongsa, Olaf Schneewind, Dominique Missiakas
Recurrent infections and immune evasion strategies of Staphylococcus aureus.
Curr Opin Microbiol: 2012, 15(1);92-9
[PubMed:22088393] [WorldCat.org] [DOI] (I p)Samuel Becker, Matthew B Frankel, Olaf Schneewind, Dominique Missiakas
Release of protein A from the cell wall of Staphylococcus aureus.
Proc Natl Acad Sci U S A: 2014, 111(4);1574-9
[PubMed:24434550] [WorldCat.org] [DOI] (I p)