PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Views

• Read
• Edit
• History

More

• Edit source

⊟Summary

• organism: Staphylococcus aureus COL
locus tag: SACOL_RS02035 [old locus tag: SACOL0404 ]
pan locus tag^?: SAUPAN001868000
symbol: SACOL_RS02035
pan gene symbol^?: mepR
• synonym:
• product: multidrug efflux MATE transporter transcriptional repressor MepR

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SACOL_RS02035 [old locus tag: SACOL0404 ]
• symbol: SACOL_RS02035
• product: multidrug efflux MATE transporter transcriptional repressor MepR
• replicon: chromosome
• strand: +
• coordinates: 410848..411267
• length: 420
• essential: unknown other strains

⊟Accession numbers

• Location: NC_002951 (410848..411267) NCBI
• BioCyc: SACOL_RS02035 BioCyc
• MicrobesOnline: see SACOL0404

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  
  ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCT
  GATCAAAAGTTAGAGCAATTTGATATTACAAATGAGCAAGGTCATACGTTAGGTTATCTT
  TATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
  GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTAT
  GTCGATGCACAAGATACGAGAAGAAAGAATATAGGGCTGACTACCTCTGGGATTAAACTC
  GTAGAAGCATTCACTTCGATATTTGATGAAATGGAACAAACACTCGTATCGCAGTTATCT
  GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA
  60
  120
  180
  240
  300
  360
  420
  

⊟Protein

• 5F6F
  PDB
• 5FFX
  PDB

Protein Data Bank: 5FFX

⊟General

• locus tag: SACOL_RS02035 [old locus tag: SACOL0404 ]
• symbol: SACOL_RS02035
• description: multidrug efflux MATE transporter transcriptional repressor MepR
• length: 139
• theoretical pI: 6.26722
• theoretical MW: 16172.2
• GRAVY: -0.669784

⊟Function

• ⊞TIGRFAM:
  homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.9)
  and 5 more
  mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30)
  Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 22.8)
  Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 20.4)
  RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.8)
  Signal transduction Regulatory functions DNA interactions aminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 13.6)
• TheSEED: see SACOL0404
• ⊞PFAM:
  HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 47.5)
  and 25 more
  MarR; MarR family (PF01047; HMM-score: 37.6)
  Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 29.7)
  HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 21.9)
  HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 21.6)
  HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.8)
  HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 19.4)
  HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 19.3)
  HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.2)
  HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)
  HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.2)
  TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.1)
  HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.1)
  DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15)
  Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 14.7)
  no clan defined DUF445; Protein of unknown function (DUF445) (PF04286; HMM-score: 14.7)
  HTH (CL0123) Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.4)
  Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.3)
  DUF1670; Protein of unknown function (DUF1670) (PF07900; HMM-score: 14.3)
  B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 13.5)
  AAA_lid (CL0671) Vps4_C; Vps4 C terminal oligomerisation domain (PF09336; HMM-score: 13.5)
  HTH (CL0123) HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 13.5)
  HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 13.1)
  no clan defined DUF6664; Family of unknown function (DUF6664) (PF20369; HMM-score: 13)
  HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.4)
  HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12.2)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:
• genes regulated by MepR*, TF important in Multidrug resistance: see SACOL0404

⊟Localization

• ⊞PSORTb: unknown (no significant prediction)
  • Cytoplasmic Score: 2.5
  • Cytoplasmic Membrane Score: 2.5
  • Cellwall Score: 2.5
  • Extracellular Score: 2.5
  • Internal Helices: 0
• ⊞DeepLocPro: Cytoplasmic
  • Cytoplasmic Score: 0.9936
  • Cytoplasmic Membrane Score: 0.0038
  • Cell wall & surface Score: 0.0004
  • Extracellular Score: 0.0022
• LocateP:
• ⊞SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.005476
  • TAT(Tat/SPI): 0.000487
  • LIPO(Sec/SPII): 0.000763
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446319561 NCBI
• RefSeq: WP_000397416 NCBI
• UniProt: see SACOL0404

⊟Protein sequence

• MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ

⊟Experimental data

• experimentally validated: see SACOL0404
• protein localization: see SACOL0404
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator: MepR* see SACOL0404

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊞Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊞Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications