Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS11090 [old locus tag: SA1930 ]
- pan locus tag?: SAUPAN005422000
- symbol: SA_RS11090
- pan gene symbol?: rpoE
- synonym:
- product: DNA-directed RNA polymerase subunit delta
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS11090 [old locus tag: SA1930 ]
- symbol: SA_RS11090
- product: DNA-directed RNA polymerase subunit delta
- replicon: chromosome
- strand: -
- coordinates: 2179741..2180271
- length: 531
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAAATTCAAGATTATACAAAACAAATGGTTGATGAAAAATCATTTATTGATATGGCT
TATACATTATTGAATGATAAAGGCGAAACTATGAACTTATATGATATCATCGATGAGTTT
AGAGCGTTAGGTGATTATGAGTACGAAGAAATTGAAAATCGCGTTGTACAATTTTACACA
GATTTAAACACAGATGGTCGTTTTTTAAATGTTGGAGAAAATTTATGGGGATTACGTGAT
TGGTATTCGGTAGATGATATTGAAGAGAAAATCGCACCAACTATTCAAAAATTCGATATT
CTGGATGCAGATGATGAAGAAGATCAAAACTTAAAATTATTGGGCGAAGATGAAATGGAT
GACGACGATGATATTCCAGCTCAAACAGATGATCAAGAAGAACTAAATGATCCAGAAGAT
GAGCAGGTTGAAGAAGAAATCAATCATTCGGATATAGTCATTGAAGAAGATGAAGATGAA
CTAGACGAAGACGAAGAAGTGTTTGAAGACGAAGAAGACTTCAACGATTAA60
120
180
240
300
360
420
480
531
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS11090 [old locus tag: SA1930 ]
- symbol: SA_RS11090
- description: DNA-directed RNA polymerase subunit delta
- length: 176
- theoretical pI: 3.36108
- theoretical MW: 20881
- GRAVY: -1.0483
⊟Function[edit | edit source]
- TIGRFAM: Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase delta subunit (TIGR04567; EC 2.7.7.6; HMM-score: 105.4)
- TheSEED: see SA1930
- PFAM: HTH (CL0123) HARE-HTH; HB1, ASXL, restriction endonuclease HTH domain (PF05066; HMM-score: 42.6)and 1 moreORC_WH_C; Origin recognition complex winged helix C-terminal (PF18137; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9817
- Cytoplasmic Membrane Score: 0.0107
- Cell wall & surface Score: 0.0028
- Extracellular Score: 0.0048
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004767
- TAT(Tat/SPI): 0.000217
- LIPO(Sec/SPII): 0.001088
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYTDLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMDDDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA_RS02930 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA_RS02935 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA_RS05355 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SA_RS07060 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) SA_RS07065 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SA_RS07955 molecular chaperone DnaK [1] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [1] (data from MRSA252) SA_RS08460 50S ribosomal protein L20 [1] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)