Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2120 [new locus tag: SACOL_RS11090 ]
- pan locus tag?: SAUPAN005422000
- symbol: rpoE
- pan gene symbol?: rpoE
- synonym:
- product: DNA-directed RNA polymerase subunit delta
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2120 [new locus tag: SACOL_RS11090 ]
- symbol: rpoE
- product: DNA-directed RNA polymerase subunit delta
- replicon: chromosome
- strand: -
- coordinates: 2181281..2181811
- length: 531
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237471 NCBI
- RefSeq: YP_186935 NCBI
- BioCyc: see SACOL_RS11090
- MicrobesOnline: 913596 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAAATTCAAGATTATACAAAACAAATGGTTGATGAAAAATCATTTATTGATATGGCT
TATACATTATTGAATGATAAAGGCGAAACAATGAACTTATATGATATCATCGATGAATTT
AGAGCGTTAGGTGATTATGAGTACGAAGAAATTGAAAATCGTGTTGTACAATTTTACACG
GATTTAAACACAGATGGTCGTTTTTTAAATGTTGGAGAAAATTTATGGGGATTACGTGAT
TGGTATTCGGTAGATGATATTGAAGAGAAAATCGCACCAACTATTCAAAAATTCGATATT
CTGGATGCAGATGATGAAGAAGATCAAAACTTAAAATTATTGGGCGAAGATGAAATGGAT
GACGACGATGATATTCCAGCTCAAACAGATGATCAAGAAGAACTAAATGATCCAGAAGAT
GAGCAGGTTGAAGAAGAAATCAATCATTCGGATATAGTCATTGAAGAAGATGAAGATGAA
CTAGACGAAGACGAAGAAGTGTTTGAAGACGAAGAAGACTTCAACGATTAA60
120
180
240
300
360
420
480
531
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2120 [new locus tag: SACOL_RS11090 ]
- symbol: RpoE
- description: DNA-directed RNA polymerase subunit delta
- length: 176
- theoretical pI: 3.36108
- theoretical MW: 20881
- GRAVY: -1.0483
⊟Function[edit | edit source]
- TIGRFAM: Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase delta subunit (TIGR04567; EC 2.7.7.6; HMM-score: 105.4)
- TheSEED :
- Transcription delta factor
- PFAM: HTH (CL0123) HARE-HTH; HB1, ASXL, restriction endonuclease HTH domain (PF05066; HMM-score: 42.6)and 1 moreORC_WH_C; Origin recognition complex winged helix C-terminal (PF18137; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9817
- Cytoplasmic Membrane Score: 0.0107
- Cell wall & surface Score: 0.0028
- Extracellular Score: 0.0048
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004767
- TAT(Tat/SPI): 0.000217
- LIPO(Sec/SPII): 0.001088
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYTDLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMDDDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 3436 [4]
- interaction partners:
SACOL1637 (dnaK) molecular chaperone DnaK [5] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [5] (data from MRSA252) SACOL1103 (pdhB) pyruvate dehydrogenase complex E1 component subunit beta [5] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [5] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [5] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [5] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [5] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [5] (data from MRSA252) SACOL0588 (rpoB) DNA-directed RNA polymerase subunit beta [5] (data from MRSA252) SACOL0589 (rpoC) DNA-directed RNA polymerase subunit beta' [5] (data from MRSA252) SACOL1449 (sucA) 2-oxoglutarate dehydrogenase E1 component [5] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [5] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 16.86 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 5.00 5.01 5.02 5.03 5.04 5.05 5.06 5.07 5.08 5.09 5.10 5.11 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)