From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10065 [old locus tag: SA1752 ]
  • pan locus tag?: SAUPAN005011000
  • symbol: SA_RS10065
  • pan gene symbol?: hlb-1
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10065 [old locus tag: SA1752 ]
  • symbol: SA_RS10065
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2005149..2005349
  • length: 201
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (2005149..2005349) NCBI
  • BioCyc: SA_RS10065 BioCyc
  • MicrobesOnline: see SA1752

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATGGTAAAAAAAACAAAATCCAATTCACTAAAAAAAGTTGCAACACTTGCATTAGCA
    AATTTATTATTAGTTGGTGCACTTACTGACAATAGTGCCAAAGCCGAATCTAAGAAAGAT
    GATACTGATTTGAAGTTAGTTAGTCATAACGTTTATATGTTATCGACCGTTTTGTATCCA
    AACTGGAGACTTTTAACATAA
    60
    120
    180
    201


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS10065 [old locus tag: SA1752 ]
  • symbol: SA_RS10065
  • description: hypothetical protein
  • length: 66
  • theoretical pI: 10.4211
  • theoretical MW: 7306.61
  • GRAVY: -0.0181818

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis sphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 14)
  • TheSEED: see SA1752
  • PFAM:

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 8.8
    • Cellwall Score: 0.22
    • Extracellular Score: 0.98
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0008
    • Cell wall & surface Score: 0.002
    • Extracellular Score: 0.9972
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 35 aa
    • SP(Sec/SPI): 0.954478
    • TAT(Tat/SPI): 0.012116
    • LIPO(Sec/SPII): 0.02226
    • Cleavage Site: CS pos: 35-36. AKA-ES. Pr: 0.9082
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MMVKKTKSNSLKKVATLALANLLLVGALTDNSAKAESKKDDTDLKLVSHNVYMLSTVLYPNWRLLT

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]