From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1873 [new locus tag: NWMN_RS10775 ]
  • pan locus tag?: SAUPAN005011000
  • symbol: NWMN_1873
  • pan gene symbol?: hlb-1
  • synonym:
  • product: truncated beta-hemolysin

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1873 [new locus tag: NWMN_RS10775 ]
  • symbol: NWMN_1873
  • product: truncated beta-hemolysin
  • replicon: chromosome
  • strand: +
  • coordinates: 2088041..2088247
  • length: 207
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGATAATGATGGTGAAAAAAACAAAATCCAATTCACTAAAAAAAGTTGCAACACTTGCA
    TTAGCAAATTTATTATTAGTTGGTGCACTTACTGACAATAGTGCCAAAGCCGAATCTAAG
    AAAGATGATACTGATTTGAAGTTAGTTAGTCATAACGTTTATATGTTATCGACCGTTTTG
    TATCCAAACTGGAGACTTTTAACATAA
    60
    120
    180
    207

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1873 [new locus tag: NWMN_RS10775 ]
  • symbol: NWMN_1873
  • description: truncated beta-hemolysin
  • length: 68
  • theoretical pI: 10.4211
  • theoretical MW: 7550.96
  • GRAVY: 0.0764706

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis sphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 13.9)
  • TheSEED: data available for N315, NCTC8325, USA300_FPR3757
  • PFAM:

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 8.8
    • Cellwall Score: 0.22
    • Extracellular Score: 0.98
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: NSAKAESK
  • SignalP: Signal peptide SP(Sec/SPI) length 37 aa
    • SP(Sec/SPI): 0.947087
    • TAT(Tat/SPI): 0.011682
    • LIPO(Sec/SPII): 0.02372
    • Cleavage Site: CS pos: 37-38. AKA-ES. Pr: 0.8992
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIMMVKKTKSNSLKKVATLALANLLLVGALTDNSAKAESKKDDTDLKLVSHNVYMLSTVLYPNWRLLT

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_1873&oldid=67763"