Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1873 [new locus tag: NWMN_RS10775 ]
- pan locus tag?: SAUPAN005011000
- symbol: NWMN_1873
- pan gene symbol?: hlb-1
- synonym:
- product: truncated beta-hemolysin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1873 [new locus tag: NWMN_RS10775 ]
- symbol: NWMN_1873
- product: truncated beta-hemolysin
- replicon: chromosome
- strand: +
- coordinates: 2088041..2088247
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332118 NCBI
- RefSeq: YP_001332907 NCBI
- BioCyc:
- MicrobesOnline: 3707461 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGATAATGATGGTGAAAAAAACAAAATCCAATTCACTAAAAAAAGTTGCAACACTTGCA
TTAGCAAATTTATTATTAGTTGGTGCACTTACTGACAATAGTGCCAAAGCCGAATCTAAG
AAAGATGATACTGATTTGAAGTTAGTTAGTCATAACGTTTATATGTTATCGACCGTTTTG
TATCCAAACTGGAGACTTTTAACATAA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1873 [new locus tag: NWMN_RS10775 ]
- symbol: NWMN_1873
- description: truncated beta-hemolysin
- length: 68
- theoretical pI: 10.4211
- theoretical MW: 7550.96
- GRAVY: 0.0764706
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis sphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 13.9)
- TheSEED :
- Beta-hemolysin
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 8.8
- Cellwall Score: 0.22
- Extracellular Score: 0.98
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0011
- Cell wall & surface Score: 0.0024
- Extracellular Score: 0.9965
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: NSAKAESK
- SignalP: Signal peptide SP(Sec/SPI) length 37 aa
- SP(Sec/SPI): 0.947087
- TAT(Tat/SPI): 0.011682
- LIPO(Sec/SPII): 0.02372
- Cleavage Site: CS pos: 37-38. AKA-ES. Pr: 0.8992
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIMMVKKTKSNSLKKVATLALANLLLVGALTDNSAKAESKKDDTDLKLVSHNVYMLSTVLYPNWRLLT
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]