From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10775 [old locus tag: NWMN_1873 ]
  • pan locus tag?: SAUPAN005011000
  • symbol: NWMN_RS10775
  • pan gene symbol?: hlb-1
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS10775 [old locus tag: NWMN_1873 ]
  • symbol: NWMN_RS10775
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2088047..2088247
  • length: 201
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2088047..2088247) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1873

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATGGTGAAAAAAACAAAATCCAATTCACTAAAAAAAGTTGCAACACTTGCATTAGCA
    AATTTATTATTAGTTGGTGCACTTACTGACAATAGTGCCAAAGCCGAATCTAAGAAAGAT
    GATACTGATTTGAAGTTAGTTAGTCATAACGTTTATATGTTATCGACCGTTTTGTATCCA
    AACTGGAGACTTTTAACATAA
    60
    120
    180
    201

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS10775 [old locus tag: NWMN_1873 ]
  • symbol: NWMN_RS10775
  • description: hypothetical protein
  • length: 66
  • theoretical pI: 10.4211
  • theoretical MW: 7306.61
  • GRAVY: -0.0181818

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis sphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 14)
  • TheSEED: data available for N315, NCTC8325, USA300_FPR3757
  • PFAM:

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 8.8
    • Cellwall Score: 0.22
    • Extracellular Score: 0.98
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 35 aa
    • SP(Sec/SPI): 0.954478
    • TAT(Tat/SPI): 0.012116
    • LIPO(Sec/SPII): 0.02226
    • Cleavage Site: CS pos: 35-36. AKA-ES. Pr: 0.9082
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MMVKKTKSNSLKKVATLALANLLLVGALTDNSAKAESKKDDTDLKLVSHNVYMLSTVLYPNWRLLT

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]