From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10035 [old locus tag: SA1748 ]
  • pan locus tag?: SAUPAN005000000
  • symbol: SA_RS10035
  • pan gene symbol?: pmtR
  • synonym:
  • product: GntR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10035 [old locus tag: SA1748 ]
  • symbol: SA_RS10035
  • product: GntR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2000108..2000488
  • length: 381
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2000108..2000488) NCBI
  • BioCyc: SA_RS10035 BioCyc
  • MicrobesOnline: see SA1748

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAATAATTTTAAAAAACAATAGTGATTTTCCGATTTATGAACAGATTAAGCAACAA
    GTAAAACAAAATATTTTAAAGGGACATGTTGCTCCTGGAGAGCATTTGCCGTCAATGAGA
    GAACTTGCCAAAGATCTTCAAGTAAGTTTGATTACTACCAAACGTGCTTATGAAGATTTA
    GAGAAAGACGGTTTTGTTACAACAATTAGAGGAAAAGGGACCTTTGTTAAGGAGCAAGAT
    AGTTCTATTTTAAAAGAGAAACAATTTTTTACCATTGAAAATTTGGTTAAAGAATTGGTT
    AATGAAGCGCAAGCCATCGAAATGTCACTTGAGGAACTTCAAGATATTTTAACGTTCATT
    TATGAGGAGGAATCATCATGA
    60
    120
    180
    240
    300
    360
    381

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS10035 [old locus tag: SA1748 ]
  • symbol: SA_RS10035
  • description: GntR family transcriptional regulator
  • length: 126
  • theoretical pI: 4.70971
  • theoretical MW: 14532.5
  • GRAVY: -0.430952

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 59.3)
    Signal transduction Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 59.3)
    and 15 more
    Metabolism Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)
    Signal transduction Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 45.2)
    Signal transduction Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 43.6)
    Signal transduction Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 35.1)
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 32.7)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.8)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
    Metabolism Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
    Signal transduction Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 23.1)
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 13.5)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 13.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transduction Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)
    Signal transduction Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 12.8)
  • TheSEED: see SA1748
  • PFAM:
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 64.4)
    and 13 more
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.8)
    Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 18.1)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.9)
    DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 15.8)
    no clan defined Uso1_p115_C; Uso1 / p115 like vesicle tethering protein, C terminal region (PF04871; HMM-score: 14.5)
    SabA_adhesion; SabA N-terminal extracellular adhesion domain (PF18304; HMM-score: 14.4)
    HTH (CL0123) HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 13.7)
    no clan defined STX6_10_61_N; Syntaxin 6/10/61, N-terminal (PF09177; HMM-score: 13.6)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.4)
    RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.4)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.1)
    MarR; MarR family (PF01047; HMM-score: 13)
    LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by PmtR*, TF important in Hypothetical ABC transporter: see SA1748

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8787
    • Cytoplasmic Membrane Score: 0.1086
    • Cell wall & surface Score: 0.0106
    • Extracellular Score: 0.002
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003235
    • TAT(Tat/SPI): 0.000192
    • LIPO(Sec/SPII): 0.000299
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEHLPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENLVKELVNEAQAIEMSLEELQDILTFIYEEESS

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]