PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

⊟Summary

• organism: Staphylococcus aureus Newman
• locus tag: NWMN_1870 [new locus tag: NWMN_RS10745 ]
• pan locus tag^?: SAUPAN005000000
• symbol: NWMN_1870
• pan gene symbol^?: pmtR
• synonym:
• product: GntR family regulatory protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: NWMN_1870 [new locus tag: NWMN_RS10745 ]
• symbol: NWMN_1870
• product: GntR family regulatory protein
• replicon: chromosome
• strand: -
• coordinates: 2082635..2083090
• length: 456
• essential: unknown other strains

⊟Accession numbers

• Gene ID: 5331139 NCBI
• RefSeq: YP_001332904 NCBI
• BioCyc:
• MicrobesOnline: 3707458 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  
  ATGAGACATGCATATTTACAAAACTGTGTATATTGTGTATATTGTATATATACAGAAGTT
  GATAGGGGGACGTTGATGAAAATAATTTTAAAAAACAATAGTGATTTTCCGATTTATGAA
  CAGATTAAGCAACAAGTAAAACAAAATATTTTAAAGGGACATGTTGCTCCTGGAGAGCAT
  TTGCCGTCAATGAGAGAACTTGCCAAAGATCTTCAAGTAAGTTTGATTACTACCAAACGT
  GCTTATGAAGATTTAGAGAAAGACGGTTTTGTTACAACAATTAGAGGAAAAGGGACCTTT
  GTTAAGGAGCAAGATAGTTCTATTTTAAAAGAGAAACAATTTTTTACCATTGAAAATTTG
  GTTAAAGAATTGGTTAATGAAGCGCAAGCCATCGAAATGTCACTTGAGGAACTGCAGGAT
  ATTTTAACGTTCATTTATGAGGAGGAATCATCATGA
  60
  120
  180
  240
  300
  360
  420
  456
  

⊟Protein

⊟General

• locus tag: NWMN_1870 [new locus tag: NWMN_RS10745 ]
• symbol: NWMN_1870
• description: GntR family regulatory protein
• length: 151
• theoretical pI: 4.88968
• theoretical MW: 17529
• GRAVY: -0.341722

⊟Function

• TIGRFAM:
  Metabolism Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 58.5)
  Signal transduction Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 58.5)
  and 13 more
  Metabolism Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 44.5)
  Signal transduction Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 44.5)
  Signal transduction Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 42.9)
  Signal transduction Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 34.4)
  phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 32)
  Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.6)
  Metabolism Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 22.5)
  Metabolism Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 22.5)
  Signal transduction Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 22.5)
  Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 13.1)
  putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 12.9)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 12.3)
  Signal transduction Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 12.3)
• TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
• PFAM:
  HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 63.9)
  and 7 more
  HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.8)
  Rrf2; Transcriptional regulator (PF02082; HMM-score: 18.7)
  HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 17.8)
  MarR; MarR family (PF01047; HMM-score: 12.6)
  MarR_2; MarR family (PF12802; HMM-score: 12.5)
  LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 12.2)
  HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 12.2)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:
• genes regulated by PmtR*, TF important in Hypothetical ABC transporter: in N315

⊟Localization

• PSORTb: Cytoplasmic
  • Cytoplasmic Score: 9.97
  • Cytoplasmic Membrane Score: 0
  • Cellwall Score: 0.01
  • Extracellular Score: 0.02
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.005667
  • TAT(Tat/SPI): 0.000109
  • LIPO(Sec/SPII): 0.001124
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 151222082 NCBI
• RefSeq: YP_001332904 NCBI
• UniProt: A0A0H3KHM2 UniProt

⊟Protein sequence

• MRHAYLQNCVYCVYCIYTEVDRGTLMKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEHLPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENLVKELVNEAQAIEMSLEELQDILTFIYEEESS

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: NWMN_1866 < NWMN_1867 < NWMN_1868 < NWMN_1869 < NWMN_1870

⊟Regulation

• data available for N315

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications