Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS09400 [old locus tag: SA1663 ]
- pan locus tag?: SAUPAN004776000
- symbol: SA_RS09400
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS09400 [old locus tag: SA1663 ]
- symbol: SA_RS09400
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1899789..1900133
- length: 345
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAGTAAATTTATATGATTATGCAAATCAATTAGAACAAGCTTTAAGAGAAAGCGAA
GAATACAAAGCAATCAAAGAAGCATTCGCTAATGTAAAAGCTAACGAAGAATCTAAAAAG
TTATTCGATGAGTTCCGTGAAACTCAAATTAACTTCCAACAAAAACAAATGCAAGGTGAA
GAAATTGCTGAAGAAGATTTACAAAAAGCGCAAGAACAAGCGCAAGCAATTGAAAAAGAT
GAAAACATCTCTGCATTAATGAATGCTGAACAAAAAATGAGTCAAGTATTCCAAGAAATC
AACCAAATTATCGTTAAACCATTAGACGAAATTTACGCTGACTAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS09400 [old locus tag: SA1663 ]
- symbol: SA_RS09400
- description: hypothetical protein
- length: 114
- theoretical pI: 4.03601
- theoretical MW: 13309.7
- GRAVY: -0.845614
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 5.7)
- TheSEED: see SA1663
- PFAM: no clan defined Com_YlbF; Control of competence regulator ComK, YlbF/YmcA (PF06133; HMM-score: 96.5)and 6 moreStriatin; Striatin family (PF08232; HMM-score: 14.5)DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 9.4)Cas_Cas1; CRISPR associated protein Cas1 (PF01867; HMM-score: 9)AD; Anticodon-binding domain (PF09793; HMM-score: 7.8)TMPIT; TMPIT-like protein (PF07851; HMM-score: 7.2)O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9961
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0
- Extracellular Score: 0.0035
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002538
- TAT(Tat/SPI): 0.000329
- LIPO(Sec/SPII): 0.000465
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGEEIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]