From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1795 [new locus tag: SAUSA300_RS09825 ]
  • pan locus tag?: SAUPAN004776000
  • symbol: SAUSA300_1795
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1795 [new locus tag: SAUSA300_RS09825 ]
  • symbol: SAUSA300_1795
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1978472..1978816
  • length: 345
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGCAGTAAATTTATATGATTATGCAAATCAATTAGAACAAGCTTTAAGAGAAAGCGAA
    GAATACAAAGCAATCAAAGAAGCATTCGCTAATGTAAAAGCTAACGAAGAATCTAAAAAG
    TTATTCGACGAGTTCCGTGAAACTCAAATTAACTTCCAACAAAAACAAATGCAAGGTGAA
    GAAATTGCTGAAGAAGATTTACAAAAAGCGCAAGAACAAGCGCAAGCAATTGAAAAAGAT
    GAAAACATCTCTGCATTAATGAATGCTGAACAAAAAATGAGTCAAGTATTCCAAGAAATC
    AACCAAATTATCGTTAAACCATTAGACGAAATTTACGCTGACTAA
    60
    120
    180
    240
    300
    345

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_1795 [new locus tag: SAUSA300_RS09825 ]
  • symbol: SAUSA300_1795
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 4.03601
  • theoretical MW: 13309.7
  • GRAVY: -0.845614

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 5.7)
  • TheSEED  :
    • UPF0342 protein YheA
  • PFAM:
    no clan defined Com_YlbF; Control of competence regulator ComK, YlbF/YmcA (PF06133; HMM-score: 90.4)
    and 8 more
    OFCC1; Orofacial cleft 1 candidate gene 1 protein (PF15680; HMM-score: 14.9)
    OmpH; Outer membrane protein (OmpH-like) (PF03938; HMM-score: 13.9)
    CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 12)
    DUF3347; Protein of unknown function (DUF3347) (PF11827; HMM-score: 11.4)
    FRB_dom; FKBP12-rapamycin binding domain (PF08771; HMM-score: 11)
    DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 10.3)
    AD; Anticodon-binding domain (PF09793; HMM-score: 8.9)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 8.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002538
    • TAT(Tat/SPI): 0.000329
    • LIPO(Sec/SPII): 0.000465
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGEEIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAUSA300_1795&oldid=100444"