From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001844 [new locus tag: EGJ38_RS09205 ]
  • pan locus tag?: SAUPAN004776000
  • symbol: EGJ38_001844
  • pan gene symbol?:
  • synonym:
  • product: YlbF/YmcA family competence regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001844 [new locus tag: EGJ38_RS09205 ]
  • symbol: EGJ38_001844
  • product: YlbF/YmcA family competence regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1883029..1883373
  • length: 345
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423785 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGCAGTAAATTTATATGATTATGCAAATCAATTAGAACAAGCTTTAAGAGAAAGCGAA
    GAATACAAAGCAATCAAAGAAGCATTCGCTAATGTAAAAGCTAACGAAGAATCTAAAAAG
    TTATTCGACGAGTTCCGTGAAACTCAAATTAACTTCCAACAAAAACAAATGCAAGGTGAA
    GAAATTGCTGAAGAAGATTTACAAAAAGCGCAAGAACAAGCGCAAGCAATTGAAAAAGAT
    GAAAACATCTCTGCATTAATGAATGCTGAACAAAAAATGAGTCAAGTATTCCAAGAAATC
    AACCAAATTATCGTTAAACCATTAGACGAAATTTACGCTGACTAA
    60
    120
    180
    240
    300
    345

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001844 [new locus tag: EGJ38_RS09205 ]
  • symbol: EGJ38_001844
  • description: YlbF/YmcA family competence regulator
  • length: 114
  • theoretical pI: 4.03601
  • theoretical MW: 13309.7
  • GRAVY: -0.845614

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 5.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined Com_YlbF; Control of competence regulator ComK, YlbF/YmcA (PF06133; HMM-score: 96.5)
    and 6 more
    Striatin; Striatin family (PF08232; HMM-score: 14.5)
    DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 9.4)
    Cas_Cas1; CRISPR associated protein Cas1 (PF01867; HMM-score: 9)
    AD; Anticodon-binding domain (PF09793; HMM-score: 7.8)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 7.2)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 6.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9961
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0035
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002538
    • TAT(Tat/SPI): 0.000329
    • LIPO(Sec/SPII): 0.000465
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423785 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGEEIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]