From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08250 [old locus tag: SA1464 ]
  • pan locus tag?: SAUPAN004244000
  • symbol: SA_RS08250
  • pan gene symbol?: yajC
  • synonym:
  • product: preprotein translocase subunit YajC

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS08250 [old locus tag: SA1464 ]
  • symbol: SA_RS08250
  • product: preprotein translocase subunit YajC
  • replicon: chromosome
  • strand: -
  • coordinates: 1673824..1674084
  • length: 261
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (1673824..1674084) NCBI
  • BioCyc: SA_RS08250 BioCyc
  • MicrobesOnline: see SA1464

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCAATTTTCATTACTAATATATATAGTCGTAATTTTTGCGGTTATGTATTTCTTGATG
    ATCAGACCACAACAAAAACGTGCGAAACAGCATCGTGAGTTGATTAATAACATTCAATCT
    GGTCAAAGAATTACAACTATTGGTGGTATTAAAGGTACTGTTAAAGCAGTAGATGAAACA
    ACTGTTGTTATTACAGTTAATGGTCATGGTACTGAATTAACTTTCGAAAAACCTGCTATT
    AAACAAGTTGACCCTTCATAA
    60
    120
    180
    240
    261

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS08250 [old locus tag: SA1464 ]
  • symbol: SA_RS08250
  • description: preprotein translocase subunit YajC
  • length: 86
  • theoretical pI: 10.3856
  • theoretical MW: 9671.32
  • GRAVY: 0.102326

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 91.3)
  • TheSEED: see SA1464
  • PFAM:
    no clan defined YajC; Preprotein translocase subunit (PF02699; HMM-score: 99.1)
    and 4 more
    OB (CL0021) RuvA_N; RuvA N terminal domain (PF01330; HMM-score: 19.6)
    no clan defined DUF150_C; RimP C-terminal SH3 domain (PF17384; HMM-score: 17.9)
    Orf78; Orf78 (ac78) (PF06024; HMM-score: 14.8)
    FixQ; Cbb3-type cytochrome oxidase component FixQ (PF05545; HMM-score: 13)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.382752
    • TAT(Tat/SPI): 0.002452
    • LIPO(Sec/SPII): 0.015131
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTVVITVNGHGTELTFEKPAIKQVDPS

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA_RS08250&oldid=82123"