Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1540 [new locus tag: NWMN_RS08640 ]
- pan locus tag?: SAUPAN004244000
- symbol: NWMN_1540
- pan gene symbol?: yajC
- synonym:
- product: preprotein translocase, YajC subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1540 [new locus tag: NWMN_RS08640 ]
- symbol: NWMN_1540
- product: preprotein translocase, YajC subunit
- replicon: chromosome
- strand: -
- coordinates: 1709135..1709395
- length: 261
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332468 NCBI
- RefSeq: YP_001332574 NCBI
- BioCyc:
- MicrobesOnline: 3707092 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCAATTTTCATTACTAATATATATAGTCGTAATTTTTGCGGTTATGTATTTCTTGATG
ATCAGACCACAACAAAAACGTGCGAAACAGCATCGTGAGTTGATTAATAACATTCAATCT
GGTCAAAGAATTACAACTATTGGTGGTATTAAAGGTACTGTTAAAGCAGTAGATGAAACA
ACTGTTGTTATTACAGTTAATGGTCATGGTACTGAATTAACTTTCGAAAAACCTGCTATT
AAACAAGTTGACCCTTCATAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1540 [new locus tag: NWMN_RS08640 ]
- symbol: NWMN_1540
- description: preprotein translocase, YajC subunit
- length: 86
- theoretical pI: 10.3856
- theoretical MW: 9671.32
- GRAVY: 0.102326
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 91.3)
- TheSEED :
- Protein translocase subunit YajC
- PFAM: no clan defined YajC; Preprotein translocase subunit (PF02699; HMM-score: 102.2)and 5 moreOB (CL0021) RuvA_N; RuvA N terminal domain (PF01330; HMM-score: 21.2)SH3 (CL0010) DUF150_C; RimP C-terminal SH3 domain (PF17384; HMM-score: 17.5)KOW2_Spt5; Transcription elongation factor SPT5, second KOW domain (PF23284; HMM-score: 14.6)no clan defined Orf78; Orf78 (ac78) (PF06024; HMM-score: 14.3)DUF211; Uncharacterized ArCR, COG1888 (PF02680; HMM-score: 14)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9975
- Cell wall & surface Score: 0
- Extracellular Score: 0.0025
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.382752
- TAT(Tat/SPI): 0.002452
- LIPO(Sec/SPII): 0.015131
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTVVITVNGHGTELTFEKPAIKQVDPS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.