From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001628
  • pan locus tag?: SAUPAN004244000
  • symbol: yajC
  • pan gene symbol?: yajC
  • synonym:
  • product: preprotein translocase subunit YajC

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001628
  • symbol: yajC
  • product: preprotein translocase subunit YajC
  • replicon: chromosome
  • strand: -
  • coordinates: 1666501..1666761
  • length: 261
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCAATTTTCATTACTAATATATATAGTCGTAATTTTTGCGGTTATGTATTTCTTGATG
    ATCAGACCACAACAAAAACGTGCGAAACAGCATCGTGAGTTGATTAATAACATTCAATCT
    GGTCAAAGAATTACAACTATTGGTGGTATTAAAGGTACTGTTAAAGCAGTAGATGAAACA
    ACTGTTGTTATTACAGTTAATGGTCATGGTACTGAATTAACTTTCGAAAAACCTGCTATT
    AAACAAGTTGACCCTTCATAA
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_001628
  • symbol: YajC
  • description: preprotein translocase subunit YajC
  • length: 86
  • theoretical pI: 10.3856
  • theoretical MW: 9671.32
  • GRAVY: 0.102326

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 91.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined YajC; Preprotein translocase subunit (PF02699; HMM-score: 102.2)
    and 5 more
    OB (CL0021) RuvA_N; RuvA N terminal domain (PF01330; HMM-score: 21.2)
    SH3 (CL0010) DUF150_C; RimP C-terminal SH3 domain (PF17384; HMM-score: 17.5)
    KOW2_Spt5; Transcription elongation factor SPT5, second KOW domain (PF23284; HMM-score: 14.6)
    no clan defined Orf78; Orf78 (ac78) (PF06024; HMM-score: 14.3)
    DUF211; Uncharacterized ArCR, COG1888 (PF02680; HMM-score: 14)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9975
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0025
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.382752
    • TAT(Tat/SPI): 0.002452
    • LIPO(Sec/SPII): 0.015131
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTVVITVNGHGTELTFEKPAIKQVDPS

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]