Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS12270 [old locus tag: SAUSA300_2221 ]
- pan locus tag?: SAUPAN005731000
- symbol: SAUSA300_RS12270
- pan gene symbol?: moaD
- synonym:
- product: molybdopterin synthase sulfur carrier subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS12270 [old locus tag: SAUSA300_2221 ]
- symbol: SAUSA300_RS12270
- product: molybdopterin synthase sulfur carrier subunit
- replicon: chromosome
- strand: -
- coordinates: 2390906..2391139
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2390906..2391139) NCBI
- BioCyc: SAUSA300_RS12270 BioCyc
- MicrobesOnline: see SAUSA300_2221
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAGGTACTTTACTTCGCAGAAATTAAAGATATATTACAAAAAGCACAGGAAGATATT
GTGCTTGAACAAGCATTGACTGTACAACAATTTGAAGATTTATTGTTTGAACGTTATCCG
CAAATCAATAATAAAAAGTTTCAAGTTGCTGTAAATGAGGAATTTGTACAAAAATCGGAT
TTCATTCAACCTAATGATACTGTTGCATTAATTCCACCGGTTAGTGGAGGTTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS12270 [old locus tag: SAUSA300_2221 ]
- symbol: SAUSA300_RS12270
- description: molybdopterin synthase sulfur carrier subunit
- length: 77
- theoretical pI: 4.19545
- theoretical MW: 8871.09
- GRAVY: -0.172727
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin converting factor, subunit 1 (TIGR01682; HMM-score: 76.7)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin MoaD family protein (TIGR01687; HMM-score: 40.8)Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine thiamine biosynthesis protein ThiS (TIGR01683; HMM-score: 16.2)
- TheSEED: see SAUSA300_2221
- PFAM: Ubiquitin (CL0072) ThiS; ThiS family (PF02597; HMM-score: 67.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9917
- Cytoplasmic Membrane Score: 0.0073
- Cell wall & surface Score: 0
- Extracellular Score: 0.001
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00173
- TAT(Tat/SPI): 0.00019
- LIPO(Sec/SPII): 0.000286
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446789715 NCBI
- RefSeq: WP_000866971 NCBI
- UniProt: see SAUSA300_2221
⊟Protein sequence[edit | edit source]
- MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_RS00080 50S ribosomal protein L9 [1] (data from MRSA252) SAUSA300_RS01155 formate acetyltransferase [1] (data from MRSA252) SAUSA300_RS01940 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_RS02795 50S ribosomal protein L11 [1] (data from MRSA252) SAUSA300_RS02800 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_RS02805 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_RS02825 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAUSA300_RS02840 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_RS02845 elongation factor G [1] (data from MRSA252) SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252) SAUSA300_RS03315 metal ABC transporter substrate-binding protein [1] (data from MRSA252) SAUSA300_RS04100 enolase [1] (data from MRSA252) SAUSA300_RS04560 NADH dehydrogenase [1] (data from MRSA252) SAUSA300_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SAUSA300_RS05855 cell division protein FtsZ [1] (data from MRSA252) SAUSA300_RS06135 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_RS06220 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_RS06290 translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_RS07100 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) SAUSA300_RS07250 serine/threonine dehydratase [1] (data from MRSA252) SAUSA300_RS07430 DNA-binding protein HU [1] (data from MRSA252) SAUSA300_RS08395 molecular chaperone DnaK [1] (data from MRSA252) SAUSA300_RS08730 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_RS08950 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SAUSA300_RS08975 pyruvate kinase [1] (data from MRSA252) SAUSA300_RS09040 universal stress protein UspA [1] (data from MRSA252) SAUSA300_RS11420 50S ribosomal protein L31 type B [1] (data from MRSA252) SAUSA300_RS12025 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_RS12075 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_RS12090 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_RS12095 50S ribosomal protein L24 [1] (data from MRSA252) SAUSA300_RS12105 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_RS12120 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_RS12125 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_RS12130 30S ribosomal protein S19 [1] (data from MRSA252) SAUSA300_RS12135 50S ribosomal protein L2 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)