From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS12105 [old locus tag: SAUSA300_2195 ]
  • pan locus tag?: SAUPAN005693000
  • symbol: SAUSA300_RS12105
  • pan gene symbol?: rpsQ
  • synonym:
  • product: 30S ribosomal protein S17

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS12105 [old locus tag: SAUSA300_2195 ]
  • symbol: SAUSA300_RS12105
  • product: 30S ribosomal protein S17
  • replicon: chromosome
  • strand: -
  • coordinates: 2366237..2366500
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGAGCGAAAGAAACGATCGTAAAGTTTATGTAGGTAAAGTTGTTTCAGACAAAATGGAC
    AAGACTATTACAGTACTTGTTGAAACTTACAAAACACACAAATTATACGGTAAACGAGTA
    AAATACTCTAAAAAATACAAAACTCATGATGAAAACAATTCAGCTAAATTAGGAGACATT
    GTTAAAATTCAAGAAACTCGTCCTTTATCAGCAACAAAACGTTTTCGTTTAGTAGAGATT
    GTTGAAGAGTCAGTAATTATTTAA
    60
    120
    180
    240
    264

Protein[edit | edit source]

Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SAUSA300_RS12105 [old locus tag: SAUSA300_2195 ]
  • symbol: SAUSA300_RS12105
  • description: 30S ribosomal protein S17
  • length: 87
  • theoretical pI: 10.362
  • theoretical MW: 10174.8
  • GRAVY: -0.696552

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03635; HMM-score: 115.3)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS17 (TIGR03630; HMM-score: 40.3)
  • TheSEED: see SAUSA300_2195
  • PFAM:
    OB (CL0021) Ribosomal_S17; Ribosomal protein S17 (PF00366; HMM-score: 109.9)
    and 1 more
    PCB_OB; Penicillin-binding protein OB-like domain (PF17092; HMM-score: 14.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.4865
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.5134
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007954
    • TAT(Tat/SPI): 0.000534
    • LIPO(Sec/SPII): 0.001166
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSERNDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDENNSAKLGDIVKIQETRPLSATKRFRLVEIVEESVII

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SAUSA300_RS0280050S ribosomal protein L1  [1] (data from MRSA252)
    SAUSA300_RS02850elongation factor Tu  [1] (data from MRSA252)
    SAUSA300_RS03530LysR family transcriptional regulator  [1] (data from MRSA252)
    SAUSA300_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SAUSA300_RS05355pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SAUSA300_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SAUSA300_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SAUSA300_RS09240glutamyl aminopeptidase  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]