Jump to navigation
		Jump to search
		
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS00175 [old locus tag: SAUSA300_0035 ]
- pan locus tag?: SAUPAN000103000
- symbol: SAUSA300_RS00175
- pan gene symbol?: hsdR
- synonym:
- product: type I restriction endonuclease
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS00175 [old locus tag: SAUSA300_0035 ]
- symbol: SAUSA300_RS00175
- product: type I restriction endonuclease
- replicon: chromosome
- strand: +
- coordinates: 42191..42451
- length: 261
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (42191..42451) NCBI
- BioCyc: SAUSA300_RS00175 BioCyc
- MicrobesOnline: see SAUSA300_0035
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241TTGTATGTAGTATATCGAGCTTCACATGAAACAGCTAAAGAAGCTTTGGGCGATAAAGAG
 TTAAGAGCCATTGCACATGAGTTAACTAAAACAGTTAAGGATAACATGAGTGTTGATTGG
 TCTAAACGAGACAGTGCTAAAGCTAAAATGAGAGTTCAAGTTAGACGCCTATTAAAGAAA
 TATGGCTATCCACCAGATCTTCAAAAAATGGCTGTGGAACAAGTTGTAGAGCAAGCAGAA
 TTAATGGCAAGTCAGCAATAA60
 120
 180
 240
 261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS00175 [old locus tag: SAUSA300_0035 ]
- symbol: SAUSA300_RS00175
- description: type I restriction endonuclease
- length: 86
- theoretical pI: 9.97653
- theoretical MW: 9923.43
- GRAVY: -0.682558
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0035
- PFAM: no clan defined T1RH-like_C; Type I restriction enzyme HindI endonuclease subunit-like, C-terminal (PF11867; HMM-score: 104.2)and 1 moreDnaB_2; Replication initiation and membrane attachment (PF07261; HMM-score: 14.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.8239
- Cytoplasmic Membrane Score: 0.0317
- Cell wall & surface Score: 0.0022
- Extracellular Score: 0.1422
 
- LocateP:
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.005452
- TAT(Tat/SPI): 0.001541
- LIPO(Sec/SPII): 0.000948
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 486201762 NCBI
- RefSeq: WP_001549961 NCBI
- UniProt: see SAUSA300_0035
⊟Protein sequence[edit | edit source]
- MYVVYRASHETAKEALGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKKYGYPPDLQKMAVEQVVEQAELMASQQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]