From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0035 [new locus tag: SAUSA300_RS00175 ]
  • pan locus tag?: SAUPAN000103000
  • symbol: SAUSA300_0035
  • pan gene symbol?: rplL
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0035 [new locus tag: SAUSA300_RS00175 ]
  • symbol: SAUSA300_0035
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 42236..42451
  • length: 216
  • essential: unknown

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGGGCGATAAAGAGTTAAGAGCCATTGCACATGAGTTAACTAAAACAGTTAAGGATAAC
    ATGAGTGTTGATTGGTCTAAACGAGACAGTGCTAAAGCTAAAATGAGAGTTCAAGTTAGA
    CGCCTATTAAAGAAATATGGCTATCCACCAGATCTTCAAAAAATGGCTGTGGAACAAGTT
    GTAGAGCAAGCAGAATTAATGGCAAGTCAGCAATAA
    60
    120
    180
    216

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_0035 [new locus tag: SAUSA300_RS00175 ]
  • symbol: SAUSA300_0035
  • description: hypothetical protein
  • length: 71
  • theoretical pI: 10.2169
  • theoretical MW: 8204.52
  • GRAVY: -0.75493

⊟Function[edit | edit source]

  • TIGRFAM:
    2-aminoethylphosphonate aminotransferase (TIGR03301; EC 2.6.1.-; HMM-score: 12.2)
  • TheSEED  :
    • Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)
    DNA Metabolism DNA Metabolism - no subcategory Restriction-Modification System  Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)
    and 1 more
    DNA Metabolism DNA Metabolism - no subcategory Type I Restriction-Modification  Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)
  • PFAM:
    no clan defined DUF3387; Domain of unknown function (DUF3387) (PF11867; HMM-score: 101.2)
    and 1 more
    DnaB_2; Replication initiation and membrane attachment (PF07261; HMM-score: 14.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004594
    • TAT(Tat/SPI): 0.000817
    • LIPO(Sec/SPII): 0.000444
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKKYGYPPDLQKMAVEQVVEQAELMASQQ

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAUSA300_0035&oldid=95906"