From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0035 [new locus tag: SACOL_RS00195 ]
  • pan locus tag?: SAUPAN000103000
  • symbol: SACOL0035
  • pan gene symbol?: rplL
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0035 [new locus tag: SACOL_RS00195 ]
  • symbol: SACOL0035
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 42707..42967
  • length: 261
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGTATGTAGTATATCGAGCTTCACATGAAACAGCTAAAGAAGCTTTGGGCGATAAAGAG
    TTAAGAGCCATTGCACATGAGTTAACTAAAACAGTTAAGGATAACATGAGTGTTGATTGG
    TCTAAACGAGACAGTGCTAAAGCTAAAATGAGAGTTCAAGTTAGACGCCTATTAAAGAAA
    TATGGCTATCCACCAGATCTTCAAAAAATGGCTGTGGAACAAGTTGTAGAGCAAGCAGAA
    TTAATGGCAAGTCAGCAATAA
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0035 [new locus tag: SACOL_RS00195 ]
  • symbol: SACOL0035
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 9.97653
  • theoretical MW: 9923.43
  • GRAVY: -0.682558

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)
    DNA Metabolism DNA Metabolism - no subcategory Restriction-Modification System  Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)
    and 1 more
    DNA Metabolism DNA Metabolism - no subcategory Type I Restriction-Modification  Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)
  • PFAM:
    no clan defined T1RH-like_C; Type I restriction enzyme HindI endonuclease subunit-like, C-terminal (PF11867; HMM-score: 104.2)
    and 1 more
    DnaB_2; Replication initiation and membrane attachment (PF07261; HMM-score: 14.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8239
    • Cytoplasmic Membrane Score: 0.0317
    • Cell wall & surface Score: 0.0022
    • Extracellular Score: 0.1422
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005452
    • TAT(Tat/SPI): 0.001541
    • LIPO(Sec/SPII): 0.000948
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MYVVYRASHETAKEALGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKKYGYPPDLQKMAVEQVVEQAELMASQQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]