Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2026 [new locus tag: SAUSA300_RS11145 ]
- pan locus tag?: SAUPAN005339000
- symbol: SAUSA300_2026
- pan gene symbol?: mazF
- synonym:
- product: PemK family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2026 [new locus tag: SAUSA300_RS11145 ]
- symbol: SAUSA300_2026
- product: PemK family protein
- replicon: chromosome
- strand: -
- coordinates: 2188018..2188380
- length: 363
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913011 NCBI
- RefSeq: YP_494672 NCBI
- BioCyc: see SAUSA300_RS11145
- MicrobesOnline: 1293541 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATTAGACGAGGAGATGTTTATTTAGCAGATTTATCACCAGTACAGGGATCTGAACAA
GGGGGAGTCAGACCTGTAGTCATAATTCAAAATGATACTGGTAATAAATATAGTCCTACA
GTTATTGTTGCGGCAATAACTGGTAGGATTAATAAAGCGAAAATACCGACACATGTAGAG
ATTGAAAAGAAAAAGTATAAGTTGGATAAAGACTCAGTTATATTATTAGAACAAATTCGT
ACACTTGATAAAAAACGATTGAAAGAAAAACTGACGTACTTATCCGATGATAAAATGAAA
GAAGTAGATAATGCACTAATGATTAGTTTAGGGCTGAATGCAGTAGCTCACCAGAAAAAT
TAG60
120
180
240
300
360
363
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2026 [new locus tag: SAUSA300_RS11145 ]
- symbol: SAUSA300_2026
- description: PemK family protein
- length: 120
- theoretical pI: 10.1686
- theoretical MW: 13441.6
- GRAVY: -0.389167
⊟Function[edit | edit source]
- reaction: EC 3.1.-.-? ExPASy
- TIGRFAM: Unknown function Enzymes of unknown specificity B12-binding domain/radical SAM domain protein, MJ_1487 family (TIGR04013; HMM-score: 11.1)
- TheSEED :
- mRNA interferase, programmed cell death toxin MazF
Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems MazEF toxin-antitoxing (programmed cell death) system Programmed cell death toxin YdcEand 1 more - PFAM: SH3 (CL0010) PemK_toxin; PemK-like, MazF-like toxin of type II toxin-antitoxin system (PF02452; HMM-score: 130.7)and 1 moreOB (CL0021) HROB; Homologous recombination OB-fold protein (PF15072; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.935
- Cytoplasmic Membrane Score: 0.0091
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.0551
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009401
- TAT(Tat/SPI): 0.00089
- LIPO(Sec/SPII): 0.001725
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]