From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2058 [new locus tag: SACOL_RS10775 ]
  • pan locus tag?: SAUPAN005339000
  • symbol: SACOL2058
  • pan gene symbol?: mazF
  • synonym:
  • product: PemK family protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2058 [new locus tag: SACOL_RS10775 ]
  • symbol: SACOL2058
  • product: PemK family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2124215..2124577
  • length: 363
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATTAGACGAGGAGATGTTTATTTAGCAGATTTATCACCAGTACAGGGATCTGAACAA
    GGGGGAGTCAGACCTGTAGTCATAATTCAAAATGATACTGGTAATAAATATAGTCCTACA
    GTTATTGTTGCGGCAATAACTGGTAGGATTAATAAAGCGAAAATACCGACACATGTAGAG
    ATTGAAAAGAAAAAGTATAAGTTGGATAAAGACTCAGTTATATTATTAGAACAAATTCGT
    ACACTTGATAAAAAACGATTGAAAGAAAAACTGACGTACTTATCCGATGATAAAATGAAA
    GAAGTAGATAATGCACTAATGATTAGTTTAGGGCTGAATGCAGTAGCTCACCAGAAAAAT
    TAG
    60
    120
    180
    240
    300
    360
    363


⊟Protein[edit | edit source]

Protein Data Bank: 2MF2
Protein Data Bank: 4MZM
Protein Data Bank: 4MZP
Protein Data Bank: 4MZT
Protein Data Bank: 5DLO

⊟General[edit | edit source]

  • locus tag: SACOL2058 [new locus tag: SACOL_RS10775 ]
  • symbol: SACOL2058
  • description: PemK family protein
  • length: 120
  • theoretical pI: 10.1686
  • theoretical MW: 13441.6
  • GRAVY: -0.389167

⊟Function[edit | edit source]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Unknown function Enzymes of unknown specificity B12-binding domain/radical SAM domain protein, MJ_1487 family (TIGR04013; HMM-score: 11.1)
  • TheSEED  :
    • mRNA interferase, programmed cell death toxin MazF
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems MazEF toxin-antitoxing (programmed cell death) system  Programmed cell death toxin YdcE
    and 1 more
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems Phd-Doc, YdcE-YdcD toxin-antitoxin (programmed cell death) systems  Programmed cell death toxin YdcE
  • PFAM:
    SH3 (CL0010) PemK_toxin; PemK-like, MazF-like toxin of type II toxin-antitoxin system (PF02452; HMM-score: 130.7)
    and 1 more
    OB (CL0021) HROB; Homologous recombination OB-fold protein (PF15072; HMM-score: 13.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.935
    • Cytoplasmic Membrane Score: 0.0091
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.0551
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009401
    • TAT(Tat/SPI): 0.00089
    • LIPO(Sec/SPII): 0.001725
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 51 [3]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

S Wu, H de Lencastre, A Tomasz
Sigma-B, a putative operon encoding alternate sigma factor of Staphylococcus aureus RNA polymerase: molecular cloning and DNA sequencing.
J Bacteriol: 1996, 178(20);6036-42
[PubMed:8830703] [WorldCat.org] [DOI] (P p)