From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1974 [new locus tag: NWMN_RS11420 ]
  • pan locus tag?: SAUPAN005339000
  • symbol: NWMN_1974
  • pan gene symbol?: mazF
  • synonym:
  • product: PemK family DNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1974 [new locus tag: NWMN_RS11420 ]
  • symbol: NWMN_1974
  • product: PemK family DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2192598..2192960
  • length: 363
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATTAGACGAGGAGATGTTTATTTAGCAGATTTATCACCAGTACAGGGATCTGAACAA
    GGGGGAGTCAGACCTGTAGTCATAATTCAAAATGATACTGGTAATAAATATAGTCCTACA
    GTTATTGTTGCGGCAATAACTGGTAGGATTAATAAAGCGAAAATACCGACACATGTAGAG
    ATTGAAAAGAAAAAGTATAAGTTGGATAAAGACTCAGTTATATTATTAGAACAAATTCGT
    ACACTTGATAAAAAACGATTGAAAGAAAAACTGACGTACTTATCCGATGATAAAATGAAA
    GAAGTAGATAATGCACTAATGATTAGTTTAGGGCTGAATGCAGTAGCTCACCAGAAAAAT
    TAG
    60
    120
    180
    240
    300
    360
    363

Protein[edit | edit source]

Protein Data Bank: 2MF2
Protein Data Bank: 4MZM
Protein Data Bank: 4MZP
Protein Data Bank: 4MZT
Protein Data Bank: 5DLO

General[edit | edit source]

  • locus tag: NWMN_1974 [new locus tag: NWMN_RS11420 ]
  • symbol: NWMN_1974
  • description: PemK family DNA-binding protein
  • length: 120
  • theoretical pI: 10.1686
  • theoretical MW: 13441.6
  • GRAVY: -0.389167

Function[edit | edit source]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Unknown function Enzymes of unknown specificity B12-binding domain/radical SAM domain protein, MJ_1487 family (TIGR04013; HMM-score: 11.1)
  • TheSEED  :
    • mRNA interferase, programmed cell death toxin MazF
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems MazEF toxin-antitoxing (programmed cell death) system  Programmed cell death toxin YdcE
    and 1 more
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems Phd-Doc, YdcE-YdcD toxin-antitoxin (programmed cell death) systems  Programmed cell death toxin YdcE
  • PFAM:
    SH3 (CL0010) PemK_toxin; PemK-like, MazF-like toxin of type II toxin-antitoxin system (PF02452; HMM-score: 130.7)
    and 1 more
    OB (CL0021) HROB; Homologous recombination OB-fold protein (PF15072; HMM-score: 13.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.935
    • Cytoplasmic Membrane Score: 0.0091
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.0551
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009401
    • TAT(Tat/SPI): 0.00089
    • LIPO(Sec/SPII): 0.001725
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]