From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1233 [new locus tag: SAUSA300_RS06685 ]
  • pan locus tag?: SAUPAN003708000
  • symbol: rpmG
  • pan gene symbol?: rpmG2
  • synonym:
  • product: 50S ribosomal protein L33

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1233 [new locus tag: SAUSA300_RS06685 ]
  • symbol: rpmG
  • product: 50S ribosomal protein L33
  • replicon: chromosome
  • strand: +
  • coordinates: 1351605..1351754
  • length: 150
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGCGCGTAAACGTAACATTAGCATGCACAGAATGTGGCGATCGTAACTATATCACTACT
    AAAAATAAACGTAATAATCCTGAGCGTATTGAAATGAAAAAATATTGCCCAAGATTAAAC
    AAATATACGTTACATCGTGAAACTAAGTAA
    60
    120
    150


⊟Protein[edit | edit source]

Protein Data Bank: 5TCU

⊟General[edit | edit source]

  • locus tag: SAUSA300_1233 [new locus tag: SAUSA300_RS06685 ]
  • symbol: RpmG
  • description: 50S ribosomal protein L33
  • length: 49
  • theoretical pI: 10.2418
  • theoretical MW: 5931.87
  • GRAVY: -1.26327

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 76.3)
  • TheSEED  :
    • LSU ribosomal protein L33p
    • LSU ribosomal protein L33p, zinc-independent
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L33p
  • PFAM:
    Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 89.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7509
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.2487
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.129447
    • TAT(Tat/SPI): 0.005131
    • LIPO(Sec/SPII): 0.067076
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: Zur* (repression) regulon
    Zur*(TF)important in Zinc homeostasis; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]