Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1233 [new locus tag: SAUSA300_RS06685 ]
- pan locus tag?: SAUPAN003708000
- symbol: rpmG
- pan gene symbol?: rpmG2
- synonym:
- product: 50S ribosomal protein L33
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1233 [new locus tag: SAUSA300_RS06685 ]
- symbol: rpmG
- product: 50S ribosomal protein L33
- replicon: chromosome
- strand: +
- coordinates: 1351605..1351754
- length: 150
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914217 NCBI
- RefSeq: YP_493930 NCBI
- BioCyc: see SAUSA300_RS06685
- MicrobesOnline: 1292748 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGCGCGTAAACGTAACATTAGCATGCACAGAATGTGGCGATCGTAACTATATCACTACT
AAAAATAAACGTAATAATCCTGAGCGTATTGAAATGAAAAAATATTGCCCAAGATTAAAC
AAATATACGTTACATCGTGAAACTAAGTAA60
120
150
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1233 [new locus tag: SAUSA300_RS06685 ]
- symbol: RpmG
- description: 50S ribosomal protein L33
- length: 49
- theoretical pI: 10.2418
- theoretical MW: 5931.87
- GRAVY: -1.26327
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 76.3)
- TheSEED :
- LSU ribosomal protein L33p
- LSU ribosomal protein L33p, zinc-independent
- PFAM: Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 89.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7509
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.2487
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.129447
- TAT(Tat/SPI): 0.005131
- LIPO(Sec/SPII): 0.067076
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: Zur* (repression) regulon
Zur* (TF) important in Zinc homeostasis; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]