Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0890 [new locus tag: SAUSA300_RS04800 ]
- pan locus tag?: SAUPAN003136000
- symbol: oppF
- pan gene symbol?: opp3F
- synonym:
- product: oligopeptide ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0890 [new locus tag: SAUSA300_RS04800 ]
- symbol: oppF
- product: oligopeptide ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 977234..978175
- length: 942
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914374 NCBI
- RefSeq: YP_493590 NCBI
- BioCyc: see SAUSA300_RS04800
- MicrobesOnline: 1292405 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGAAAAATGATGAAGTGCTATTATCTATTAAAAATTTAAAGCAATATTTTAACGCAGGA
AAGAAAAACGAAGTGAGAGCGATTGAAAATATTTCGTTTGATATATACAAAGGGGAAACA
TTAGGTTTAGTAGGAGAATCGGGGTGTGGTAAATCTACAACTGGTAAATCAATTATTAAA
CTTAATGATATTACAAGTGGAGAAATTTTGTATGAGGGTATTGATATACAAAAGATTCGT
AAACGTAAAGATTTGCTTAAATTTAATAAAAAGATACAGATGATTTTTCAAGACCCATAT
GCGTCTTTAAATCCTAGGTTAAAAGTAATGGATATAGTAGCTGAAGGTATTGATATCCAT
CATTTAGCAACTGATAAGCGTGACCGAAAAAAACGTGTCTATGATTTACTTGAAACTGTT
GGATTAAGTAAAGAACATGCCAATCGCTATCCTCATGAATTTTCAGGTGGACAACGCCAA
CGTATTGGAATTGCCCGTGCATTAGCCGTTGAACCAGAATTCATTATCGCGGACGAACCA
ATATCGGCATTGGATGTTTCAATCCAAGCTCAAGTAGTTAATTTATTATTAAAATTACAA
CGTGAAAGAGGGATTACGTTCCTATTTATAGCTCATGATCTATCAATGGTGAAGTATATT
TCAGATCGTATTGCAGTCATGCATTTTGGGAAAATAGTTGAAATTGGACCGGCAGAAGAA
ATTTATCAAAATCCATTACACGATTATACTAAGTCTTTATTATCAGCCATTCCACAACCT
GATCCTGAATCAGAACGCAGTCGCAAACGATTTAGTTATATTGATGATGAAGCAAATAAT
CATTTAAGACAATTACATGAAATTAGACCGAATCACTTTGTCTTTAGTACTGAAGAAGAA
GCGGCACAACTACGAGAAAATAAATTGGTGACACAAAATTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
942
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0890 [new locus tag: SAUSA300_RS04800 ]
- symbol: OppF
- description: oligopeptide ABC transporter ATP-binding protein
- length: 313
- theoretical pI: 8.39824
- theoretical MW: 35821.8
- GRAVY: -0.448882
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 241.5)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 195.2)and 70 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 192.8)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 175.2)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 168.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 168.1)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 167.6)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 166.5)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 163.9)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 161.3)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 157.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 152.3)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 147.1)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 146.9)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 145.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 142.4)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 138.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 134.7)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 124.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 120.5)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 120.5)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.8)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 116.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 116.5)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 114.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 114.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 114.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 107.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 107.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 106.3)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 106.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 105.9)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 105.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 105.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 105.6)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 105.6)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 104.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 103.9)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 102.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 100.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 97.8)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 95.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 95)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 93.7)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 92.6)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 91)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 89.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 88.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 84.5)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 83.9)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 82.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 78.8)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 76.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 69.7)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 67.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 67.5)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 59.6)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 57.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 57.1)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 48.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 45.4)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 44.3)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 42.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 41.2)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 41.2)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36)Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 34.6)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 29.1)
- TheSEED :
- Oligopeptide ABC transporter (EC 7.4.2.6), ATP-binding protein OppF
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 121)and 8 moreno clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 35.6)P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 25.8)AAA_22; AAA domain (PF13401; HMM-score: 17.4)AIG1; AIG1 family (PF04548; HMM-score: 15.8)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 15.6)TIM_barrel (CL0036) Glyco_hydro_30; Glycosyl hydrolase family 30 TIM-barrel domain (PF02055; HMM-score: 14.9)P-loop_NTPase (CL0023) RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1054
- Cytoplasmic Membrane Score: 0.876
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0184
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.105461
- TAT(Tat/SPI): 0.001509
- LIPO(Sec/SPII): 0.00521
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIKLNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIHHLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEPISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEEIYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIDDEANNHLRQLHEIRPNHFVFSTEEEAAQLRENKLVTQN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_1080 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SAUSA300_0996 (lpdA) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SAUSA300_1644 (pyk) pyruvate kinase [1] (data from MRSA252) SAUSA300_1134 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_1149 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_2198 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_0533 (tuf) elongation factor Tu [1] (data from MRSA252) SAUSA300_2066 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SAUSA300_0658 LysR family transcriptional regulator [1] (data from MRSA252) SAUSA300_1656 universal stress protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Aurelia Hiron, Elise Borezée-Durant, Jean-Christophe Piard, Vincent Juillard
Only one of four oligopeptide transport systems mediates nitrogen nutrition in Staphylococcus aureus.
J Bacteriol: 2007, 189(14);5119-29
[PubMed:17496096] [WorldCat.org] [DOI] (P p)