From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN005131000
  • symbol?:
  • synonym:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • helix-turn-helix domain-containing protein
    • phage transcriptional regulator
    • putative phage transcriptional regulator
    • DNA-binding protein, phage associated
    • helix-turn-helix family protein
    • phage DNA-binding protein
    • Phage transcriptional regulator, Cro/CI family
  • strand?: -
  • coordinates?: 5266538..5266801
  • synteny block?: BlockID0039830
  • occurrence?: in 29% of 34 strains

mor (cro) : prophage modulator of repression protein [1]

Staphylococcal prophage typically employ a lysogenic-lytic regulatory switch analogous to the cI-cro system in coliphage lambda. cI binding drives "leftward" transcription of lysogeny modules only. cro (or more accurately "mor") binds to cI as a heterodimer (or occasionally to itself as a homodimer) and drives "rightward" transcription of lytic modules. Strong evolutionary pressures drive diversity in cI-cro DNA operator sequences to allow independent regulation of prophages in the context of multiple integrated prophage. Known or suspected operator sequences are reproduced below:

Prophage Prototype Accession Number cI protein DNA-binding residues Crystal Structure cI Operator mor protein DNA binding residues Crystal Structure mor Operator  cI-mor heterodimer  References
φ11 AF424781 AAL82233.1         Q25, D26, A37, S40, T44, G45 TTTRC-n5-GTRTA AAL82234.1         Q16, E17, E28, R31, L35, G36 TACACG-n3-CGTGTA No [2]
φ12 AF424782 AAL82286.1 Q24, K25, S36, S39, N43, L44 n.a. ATAYGAAA-n-TTTCRTAT AAL82287.1 Q15, K16, R27, Q30, K34, D35 3MLF WWMGWAAAR Yes [2]
φ13 AF424783 AAL82333.1 P29, Y30, S41, S44, N48, D49 AGTTCATR-n3-CRTGAAYT AAL82334.1 Q19, Y20, R31, S34, N38, G39 TSAAYAMAA Yes [2]
φ29 AY954964 AAX91741.1 AYWWTACG-n7-CGTAWWRT AAX91764.1 Q24, A25, D36, H39, K43, G44
φ47 AY954957 AAX91211.1 DWHRAMAC-n4-GTKTYDWH AAX91242.1
φ77 AY508486 AAR87883.1 P28, F29, S40, S43, N47, G48 AAR87930.1
φ80α DQ517338 ABF71577.1 Q19, S20, N31, S34, N38, G39 WTGTACAK-n4-CYGWACAA ABF71578.1 Q21, S22, T33, N36, Q40, G41 TWCATWT Yes [3]
φCA347 M18, E19, G38, S41, N45, E46 WCGAAACW Q24, K25, S36, S39, N46, G47 YRACAACTW Yes [4]
φNM1 AP009351 BAF68084.1 K18, V19, G30, R33, S37, G38 [5]
φST9-B L18, Q19, G41, S44, N48, N49 N18, K19, T30, N33, N37, N40
φX2 AY954968 AAX92026.1 V18, K19, T30, R33, R38, G39 ATACGAAAA AAX92036.1 L16, V17, Q28, S31, N35, G36 [6]
Prophage Prototype Accession Number cI* Protein DNA-binding residues Crystal Structure cI* Operator mor protein DNA-binding residues Crystal Structure mor Operator cI*-mor heterodimer References
φ80 DQ908929 ABJ88853.1 Q25, V26, S37, S40, K44, E45 TATYAC-n5-GTRATA ABJ88854.1 Q21, Q22, Q33, I36, K40, D41 [7]
φ88 AY954966 AAX91907.1 Q21, T22, S33, S36, N40, A41 AAX91914.1 Q21, E22, A33, I36, K40, G41 [8]
φR4 MT366568 QJT70710.1 Q25, R26, P37, S40, Q44, Q45 GTAATA QJT70730.1 Q18, Q19, K30, G33, K37, D38 [9]
φROSA NC_007058 YP_240340.1 L22, T23, S34, S37, N41, G42 YP_240342.1 I20, S21, G32, S35, N39, G40 [10]
φ187 AY954950 AAX90724.1 L22, S23, S34, S37, N41, L42 AWTARCD-n4-HGYTAWT AAX90725.1 Q19, D20, R31, A35, D39, G40 [11]
φSA75 MT013111 QIA28762.1 GAAATKTR QIA28763.1 N21, K22, A33, S36, R40, G41 [12]
φSLT AB045978 BAB21700.1 L18, A19, A30, Q33, S37, G38 AAAASTTTMG I19, K20, D31, S34, H38, G39 [13]

For annotation of individual genomes, a recommended naming convention would be to use the prophage prototype in the description, as in "prophage φ12-like induction repressor cI" for SAUSA300_1969 from strain USA300_FPR3757.

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    JSNZ:
    04-02981:
    SA2981_1958
    08BA02176:
    11819-97:
    6850:
    71193:
    ST398NM01_2957
    ECT-R 2:
    ECTR2_1867
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2099
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_19940
    USA300_TCH1516:
    USA300HOU_2003
    VC40:

Genome Viewer[edit | edit source]

N315
NCTC8325
Newman
USA300_FPR3757

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.505)


    N315            ------------------------------------------------------------
    NCTC8325        ------------------------------------------------------------
    Newman          ------------------------------------------------------------
    USA300_FPR3757  MRNFLMFLAIIIFLSLFILLTSFFLIIRNFHIIVKFFYEKNVFNVDNTKISYYIRFTKGG
                                                                                

    N315            --MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
    NCTC8325        --MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
    Newman          --MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
    USA300_FPR3757  DNMKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
                      **********************************************************

    N315            FLGNEYENFVFTNDKKKSIILAFKEKQTS
    NCTC8325        FLGNEYENFVFTNDKKKSIILAFKEKQTS
    Newman          FLGNEYENFVFTNDKKKSIILAFKEKQTS
    USA300_FPR3757  FLGNEYENFVFTNDKKKSIILAFKEKQTS
                    *****************************

  1. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  2. 2.0 2.1 2.2 John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Tony Kwan, Jing Liu, Michael DuBow, Philippe Gros, Jerry Pelletier
    The complete genomes and proteomes of 27 Staphylococcus aureus bacteriophages.
    Proc Natl Acad Sci U S A: 2005, 102(14);5174-9
    [PubMed:15788529] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Anindya Biswas, Sukhendu Mandal, Subrata Sau
    Identification and characterization of a CI binding operator at a distant location in the temperate staphylococcal phage ф11.
    FEMS Microbiol Lett: 2017, 364(20);
    [PubMed:28961814] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
    Mohammed A Thabet, José R Penadés, Andreas F Haag
    The ClpX protease is essential for inactivating the CI master repressor and completing prophage induction in Staphylococcus aureus.
    Nat Commun: 2023, 14(1);6599
    [PubMed:37852980] [WorldCat.org] [DOI] (I e)
  3. Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  4. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  5. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  6. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  7. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    G E Christie, A M Matthews, D G King, K D Lane, N P Olivarez, S M Tallent, S R Gill, R P Novick
    The complete genomes of Staphylococcus aureus bacteriophages 80 and 80α--implications for the specificity of SaPI mobilization.
    Virology: 2010, 407(2);381-90
    [PubMed:20869739] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  8. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  9. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  10. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  11. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Tony Kwan, Jing Liu, Michael DuBow, Philippe Gros, Jerry Pelletier
    The complete genomes and proteomes of 27 Staphylococcus aureus bacteriophages.
    Proc Natl Acad Sci U S A: 2005, 102(14);5174-9
    [PubMed:15788529] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  12. John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  13. S Narita, J Kaneko, J Chiba, Y Piémont, S Jarraud, J Etienne, Y Kamio
    Phage conversion of Panton-Valentine leukocidin in Staphylococcus aureus: molecular analysis of a PVL-converting phage, phiSLT.
    Gene: 2001, 268(1-2);195-206
    [PubMed:11368915] [WorldCat.org] [DOI] (P p)
    John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)
    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)
    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)
    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)
    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)
    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)