From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1804 [new locus tag: SA_RS10360 ]
  • pan locus tag?: SAUPAN005131000
  • symbol: SA1804
  • pan gene symbol?: —
  • synonym:
  • product: transcriptional regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1804 [new locus tag: SA_RS10360 ]
  • symbol: SA1804
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2044293..2044556
  • length: 264
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAACATTAAAAGAGTTGAGGACTGATTACGGATTGACTCAAAAAGAGTTAGGAGAT
    TTATTTAAGGTCTCATCACGTACAATTCAAAATATGGAAAAAGACTCTACAAACATTAAA
    GATAGTTTACTTTCTAAGTATATGAGTGCTTTTAATGTTAAATATGATGATATTTTTTTA
    GGTAATGAATACGAAAATTTCGTATTTACGAACGATAAAAAGAAATCAATTATTTTAGCA
    TTTAAAGAAAAACAAACATCTTAA
    60
    120
    180
    240
    264

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1804 [new locus tag: SA_RS10360 ]
  • symbol: SA1804
  • description: transcriptional regulator
  • length: 87
  • theoretical pI: 9.38942
  • theoretical MW: 10174.6
  • GRAVY: -0.678161

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)
    and 1 more
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 21.7)
  • TheSEED  :
    • Phage transcriptional regulator cro
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 39.1)
    and 8 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 28.3)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 22.9)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 17.2)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.8)
    HTH_11; HTH domain (PF08279; HMM-score: 16.6)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.3)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 14.6)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006591
    • TAT(Tat/SPI): 0.000691
    • LIPO(Sec/SPII): 0.001053
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDIFLGNEYENFVFTNDKKKSIILAFKEKQTS

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA1804&oldid=85674"