From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1920 [new locus tag: NWMN_RS11075 ]
  • pan locus tag?: SAUPAN005131000
  • symbol: NWMN_1920
  • pan gene symbol?:
  • synonym:
  • product: phage transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1920 [new locus tag: NWMN_RS11075 ]
  • symbol: NWMN_1920
  • product: phage transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2127771..2128034
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAACATTAAAAGAGTTGAGGACTGATTACGGATTGACTCAAAAAGAGTTAGGAGAT
    TTATTTAAGGTCTCATCACGTACAATTCAAAATATGGAAAAAGACTCTACAAACATTAAA
    GATAGTTTACTTTCTAAGTATATGAGTGCTTTTAATGTTAAATATGATGATATTTTTTTA
    GGTAATGAATACGAAAATTTCGTATTTACGAATGATAAAAAGAAATCAATTATTTTAGCA
    TTTAAAGAAAAACAAACATCTTAA
    60
    120
    180
    240
    264

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1920 [new locus tag: NWMN_RS11075 ]
  • symbol: NWMN_1920
  • description: phage transcriptional regulator
  • length: 87
  • theoretical pI: 9.38942
  • theoretical MW: 10174.6
  • GRAVY: -0.678161

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)
    and 1 more
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 21.7)
  • TheSEED  :
    • Phage transcriptional regulator cro
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 40.6)
    and 9 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 24.2)
    Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 20.7)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 20.2)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 17.5)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 16.9)
    HTH_11; HTH domain (PF08279; HMM-score: 16.8)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.6)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.1)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 11.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9424
    • Cytoplasmic Membrane Score: 0.0084
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.0483
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006591
    • TAT(Tat/SPI): 0.000691
    • LIPO(Sec/SPII): 0.001053
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDIFLGNEYENFVFTNDKKKSIILAFKEKQTS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]