From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_03001
  • pan locus tag?: SAUPAN006410000
  • symbol: SAOUHSC_03001
  • pan gene symbol?: icaR
  • synonym:
  • product: ica operon transcriptional regulator IcaR

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_03001
  • symbol: SAOUHSC_03001
  • product: ica operon transcriptional regulator IcaR
  • replicon: chromosome
  • strand: -
  • coordinates: 2774450..2775010
  • length: 561
  • essential: no [1] DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAAGGATAAGATTATTGATAACGCAATAACCTTATTTTCAGAGAAGGGGTATGACGGT
    ACAACACTTGATGATATAGCTAAAAGTGTAAATATAAAGAAAGCGAGTTTATATTACCAT
    TTTGACTCGAAAAAAAGTATTTACGAACAAAGTGTTAAATGTTGTTTTGATTACCTTAAT
    AATATTATTATGATGAATCAAAATAAATCGAACTATTCAATTGATGCTTTATATCAATTC
    TTATTTGAGTTTATTTTCGACATCGAAGAAAGGTATATTAGAATGTACGTTCAATTATCT
    AATACGCCTGAGGAATTTTCTGGAAATATTTACGGACAAATACAAGATTTAAATCAATCA
    TTAAGTAAAGAGATAGCAAAATTCTATGATGAATCAAAGATAAAGATGACAAAAGAAGAC
    TTTCAGAATTTAATATTGCTGTTTCTTGAAAGTTGGTATTTGAAAGCATCCTTTTCGCAA
    AAATTTGGAGCAGTGGAAGAAAGTAAAAGTCAATTCAAAGATGAAGTGTATTCGCTACTA
    AATATATTTTTGAAGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    561

Protein[edit | edit source]

Protein Data Bank: 3GEU

General[edit | edit source]

  • locus tag: SAOUHSC_03001
  • symbol: SAOUHSC_03001
  • description: ica operon transcriptional regulator IcaR
  • length: 186
  • theoretical pI: 4.91883
  • theoretical MW: 21986.9
  • GRAVY: -0.376344

Function[edit | edit source]

  • TIGRFAM:
    pyrimidine utilization regulatory protein R (TIGR03613; HMM-score: 33.1)
    Signal transduction Regulatory functions DNA interactions mycofactocin system transcriptional regulator (TIGR03968; HMM-score: 32.8)
    and 1 more
    Signal transduction Regulatory functions DNA interactions transcriptional repressor BetI (TIGR03384; HMM-score: 26.3)
  • TheSEED  :
    • Biofilm operon icaABCD HTH-type negative transcriptional regulator IcaR
    Regulation and Cell signaling Quorum sensing and biofilm formation Biofilm formation in Staphylococcus  Biofilm operon icaABCD HTH-type negative transcriptional regulator IcaR
  • PFAM:
    TetR_C (CL0174) TetR_C_37; Tetracyclin repressor-like, C-terminal domain (PF18665; HMM-score: 90.9)
    and 3 more
    HTH (CL0123) TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 59.6)
    B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 16)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 14.1)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7681
    • Cytoplasmic Membrane Score: 0.1896
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.042
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021785
    • TAT(Tat/SPI): 0.000661
    • LIPO(Sec/SPII): 0.003606
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: IcaR* (repression) regulon
    IcaR*(TF)important in Intercellular adhesion; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here.

Literature[edit | edit source]

References[edit | edit source]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

S E Cramton, C Gerke, N F Schnell, W W Nichols, F Götz
The intercellular adhesion (ica) locus is present in Staphylococcus aureus and is required for biofilm formation.
Infect Immun: 1999, 67(10);5427-33
[PubMed:10496925] [WorldCat.org] [DOI] (P p)
David Cue, Mei G Lei, Chia Y Lee
Activation of sarX by Rbf is required for biofilm formation and icaADBC expression in Staphylococcus aureus.
J Bacteriol: 2013, 195(7);1515-24
[PubMed:23354746] [WorldCat.org] [DOI] (I p)