From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02650
  • pan locus tag?: SAUPAN005883000
  • symbol: SAOUHSC_02650
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02650
  • symbol: SAOUHSC_02650
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2436751..2437380
  • length: 630
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAGATTAGTTACAGGGTTACTAGCATTATCATTATTTTTAGCTGCATGTGGTCAA
    GATAGTGACCAACAAAAAGACGGTAATAAAGAAAAAGATGATAAAGCGAAAACTGAACAA
    CAAGATAAAAAAACAAATGATTCATCTAAAGATAAGAAAGATAATAAAGATGATAGTAAA
    GACGTAAACAAAGATAATAAAGATAATAGTGCAAACGATAACCAGCAACAATCTAATTCA
    AATGCAACAAACAATGACCAAAACCAAACAAATAATAACCAATCAAGTAATAACCAAGCG
    AATAATAATCAAAAATCAAGTTACGTTGCACCATATTATGGACAAAATGCCGCGCCGGTT
    GCACGTCAAATTTATCCGTTTAATGGAAATAAAAATCAAGCTTTACAGCAATTGCCAAAT
    TTCCAAACAGCTTTAAATGCGGCTAATAATGAAGCAAATAAATTTGGTAGTAATAATAAA
    GTGTATAATGATTATTCTATTGAAGAACATAATGGCAACTATAAGTATGTGTTTAGTTTT
    AAAGACCCAAATGCAAATGGAAAATATTCAATTGTAACGGTTGATTATACTGGACAAGCA
    ATGGTTACTGATCCAAACTACCAACAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    630

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02650
  • symbol: SAOUHSC_02650
  • description: hypothetical protein
  • length: 209
  • theoretical pI: 5.97547
  • theoretical MW: 23361.8
  • GRAVY: -1.44067

Function[edit | edit source]

  • TIGRFAM:
    Sec region non-globular protein (TIGR04420; HMM-score: 17.8)
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 14.5)
    and 6 more
    type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 13.7)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 9)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 6.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 4.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 4.1)
  • TheSEED  :
    • hypothetical protein similar to TpgX
  • PFAM:
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 17)
    HAD (CL0137) CDC45; CDC45 (PF02724; HMM-score: 13.7)
    and 20 more
    MFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 13)
    no clan defined PCYCGC; Protein of unknown function with PCYCGC motif (PF13798; HMM-score: 12.6)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.9)
    no clan defined Nop14; Nop14-like family (PF04147; HMM-score: 11.8)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.7)
    no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 10.1)
    SLC12; Solute carrier family 12 (PF03522; HMM-score: 9.7)
    DUF6474; Family of unknown function (DUF6474) (PF20079; HMM-score: 8.4)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 8.1)
    no clan defined TMEM51; Transmembrane protein 51 (PF15345; HMM-score: 7.6)
    MCM_bind; Mini-chromosome maintenance replisome factor (PF09739; HMM-score: 7.5)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 7.5)
    no clan defined DUF4614; Domain of unknown function (DUF4614) (PF15391; HMM-score: 7.5)
    Mat89Bb; Cell cycle and development regulator Mat89Bb (PF10221; HMM-score: 7.1)
    GCV_T_C (CL0740) POP1_C; POP1 C-terminal domain (PF22770; HMM-score: 6.9)
    Peptidase_PA (CL0124) Peptidase_S64; Peptidase family S64 (PF08192; HMM-score: 6.7)
    NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 6.4)
    no clan defined Otopetrin; Otopetrin (PF03189; HMM-score: 5.9)
    DUF7502; Family of unknown function (DUF7502) (PF24334; HMM-score: 5.8)
    Raftlin; Raftlin (PF15250; HMM-score: 5.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 7.21
    • Cellwall Score: 1.45
    • Extracellular Score: 1.34
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.7858
    • Cell wall & surface Score: 0.0367
    • Extracellular Score: 0.1773
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: FLAACGQ
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000394
    • TAT(Tat/SPI): 0.000051
    • LIPO(Sec/SPII): 0.999411
    • Cleavage Site: CS pos: 17-18. LAA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSKDVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPVARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSFKDPNANGKYSIVTVDYTGQAMVTDPNYQQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [4] [3]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 3.2 3.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  4. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]