From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2158 [new locus tag: SA_RS12390 ]
  • pan locus tag?: SAUPAN005883000
  • symbol: SA2158
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2158 [new locus tag: SA_RS12390 ]
  • symbol: SA2158
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2425679..2426293
  • length: 615
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAGATTAGTTACAGGGTTACTAGCATTATCATTATTTTTAGCTGCATGTGGTCAA
    GATAGTGACCAACAAAAAGACAGTAATAAAGAAAAAGATGATAAAGCGAAAACTGAACAA
    CAAGATAAAAAAACAAATGATTCATCTAAAGATAAGAAAGACAATAAAGATGATAGTAAA
    GACGTAAACAAAGATAATAAAGATAATAGTGCAAACGATAACCAGCAACAATCTAATTCA
    AATGCAACAAACAATGACCAAAACCAAACAAATAATAACCAATCAAGTAATAATCAAAAA
    TCAAGTTACGTTGCACCATATTATGGACAAAATGCCGCGCCGGTTGCACGTCAAATTTAT
    CCGTTTAATGGAAATAAAACTCAAGCTTTACAGCAATTGCCAAATTTCCAAACAGCTTTA
    AATGCGGCTAATAATGAAGCAAATAAATTTGGTAGTAATAATAAAGTGTATAATGATTAT
    TCTATTGAAGAACATAATGGCAACTATAAGTATGTGTTTAGTTTTAAAGACCCAAATGCA
    AATGGAAAATATTCAATTGTAACGGTTGATTATACTGGACAAGCAATGGTTACTGATCCA
    AACTACCAACAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2158 [new locus tag: SA_RS12390 ]
  • symbol: SA2158
  • description: hypothetical protein
  • length: 204
  • theoretical pI: 5.97547
  • theoretical MW: 22837.3
  • GRAVY: -1.40441

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 15.3)
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 14.5)
    and 6 more
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 9.9)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 6.8)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 6.3)
    Sec region non-globular protein (TIGR04420; HMM-score: 5.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 5.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 5.1)
  • TheSEED  :
    • hypothetical protein similar to TpgX
  • PFAM:
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 15.7)
    HAD (CL0137) CDC45; CDC45 (PF02724; HMM-score: 14.4)
    no clan defined Nop14; Nop14-like family (PF04147; HMM-score: 14.1)
    and 22 more
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.9)
    no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 11.8)
    PCYCGC; Protein of unknown function with PCYCGC motif (PF13798; HMM-score: 11.6)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.3)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 10.1)
    no clan defined DUF6474; Family of unknown function (DUF6474) (PF20079; HMM-score: 9.9)
    SLC12; Solute carrier family 12 (PF03522; HMM-score: 9.7)
    MFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 9.4)
    NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 8.3)
    no clan defined MCM_bind; Mini-chromosome maintenance replisome factor (PF09739; HMM-score: 8)
    Otopetrin; Otopetrin (PF03189; HMM-score: 7.8)
    DUF913; Domain of Unknown Function (DUF913) (PF06025; HMM-score: 7.8)
    RR_TM4-6; Ryanodine Receptor TM 4-6 (PF06459; HMM-score: 7.7)
    TMEM51; Transmembrane protein 51 (PF15345; HMM-score: 7.3)
    P-loop_NTPase (CL0023) Hydin_ADK; Hydin Adenylate kinase-like domain (PF17213; HMM-score: 7)
    no clan defined Mat89Bb; Cell cycle and development regulator Mat89Bb (PF10221; HMM-score: 6.8)
    Peptidase_PA (CL0124) Peptidase_S64; Peptidase family S64 (PF08192; HMM-score: 6.7)
    no clan defined DUF7502; Family of unknown function (DUF7502) (PF24334; HMM-score: 6.7)
    PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 6.4)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 5.7)
    no clan defined Raftlin; Raftlin (PF15250; HMM-score: 5.3)
    Peptidase_CA (CL0125) Menin; Menin (PF05053; HMM-score: 4.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.775
    • Cell wall & surface Score: 0.0361
    • Extracellular Score: 0.1888
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 0
    • Predicted Cleavage Site: FLAACGQ
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000384
    • TAT(Tat/SPI): 0.00005
    • LIPO(Sec/SPII): 0.999423
    • Cleavage Site: CS pos: 17-18. LAA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKRLVTGLLALSLFLAACGQDSDQQKDSNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSKDVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQKSSYVAPYYGQNAAPVARQIYPFNGNKTQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSFKDPNANGKYSIVTVDYTGQAMVTDPNYQQ

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]