From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2365 [new locus tag: SACOL_RS12420 ]
  • pan locus tag?: SAUPAN005883000
  • symbol: SACOL2365
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2365 [new locus tag: SACOL_RS12420 ]
  • symbol: SACOL2365
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2426087..2426716
  • length: 630
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAGATTAGTTACAGGGTTACTAGCATTATCATTATTTTTAGCTGCATGTGGTCAA
    GATAGTGACCAACAAAAAGACGGTAATAAAGAAAAAGATGATAAAGCGAAAACTGAACAA
    CAAGATAAAAAAACAAATGATTCATCTAAAGATAAGAAAGATAATAAAGATGATAGTAAA
    GACGTAAACAAAGATAATAAAGATAATAGTGCAAACGATAACCAGCAACAATCTAATTCA
    AATGCAACAAACAATGACCAAAACCAAACAAATAATAACCAATCAAGTAATAACCAAGCG
    AATAATAATCAAAAATCAAGTTACGTTGCACCATATTATGGACAAAATGCCGCGCCGGTT
    GCACGTCAAATTTATCCGTTTAATGGAAATAAAAATCAAGCTTTACAGCAATTGCCAAAT
    TTCCAAACAGCTTTAAATGCGGCTAATAATGAAGCAAATAAATTTGGTAGTAATAATAAA
    GTGTATAATGATTATTCTATTGAAGAACATAATGGCAACTATAAGTATGTGTTTAGTTTT
    AAAGACCCAAATGCAAATGGAAAATATTCAATTGTAACGGTTGATTATACTGGACAAGCA
    ATGGTTACTGATCCAAACTACCAACAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    630


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2365 [new locus tag: SACOL_RS12420 ]
  • symbol: SACOL2365
  • description: hypothetical protein
  • length: 209
  • theoretical pI: 5.97547
  • theoretical MW: 23361.8
  • GRAVY: -1.44067

⊟Function[edit | edit source]

  • TIGRFAM:
    Sec region non-globular protein (TIGR04420; HMM-score: 17.8)
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 14.5)
    and 6 more
    type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 13.7)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 9)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 6.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 4.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 4.1)
  • TheSEED  :
    • hypothetical protein similar to TpgX
  • PFAM:
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 17)
    HAD (CL0137) CDC45; CDC45 (PF02724; HMM-score: 13.7)
    and 20 more
    MFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 13)
    no clan defined PCYCGC; Protein of unknown function with PCYCGC motif (PF13798; HMM-score: 12.6)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.9)
    no clan defined Nop14; Nop14-like family (PF04147; HMM-score: 11.8)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.7)
    no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 10.1)
    SLC12; Solute carrier family 12 (PF03522; HMM-score: 9.7)
    DUF6474; Family of unknown function (DUF6474) (PF20079; HMM-score: 8.4)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 8.1)
    no clan defined TMEM51; Transmembrane protein 51 (PF15345; HMM-score: 7.6)
    MCM_bind; Mini-chromosome maintenance replisome factor (PF09739; HMM-score: 7.5)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 7.5)
    no clan defined DUF4614; Domain of unknown function (DUF4614) (PF15391; HMM-score: 7.5)
    Mat89Bb; Cell cycle and development regulator Mat89Bb (PF10221; HMM-score: 7.1)
    GCV_T_C (CL0740) POP1_C; POP1 C-terminal domain (PF22770; HMM-score: 6.9)
    Peptidase_PA (CL0124) Peptidase_S64; Peptidase family S64 (PF08192; HMM-score: 6.7)
    NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 6.4)
    no clan defined Otopetrin; Otopetrin (PF03189; HMM-score: 5.9)
    DUF7502; Family of unknown function (DUF7502) (PF24334; HMM-score: 5.8)
    Raftlin; Raftlin (PF15250; HMM-score: 5.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 7.21
    • Cellwall Score: 1.45
    • Extracellular Score: 1.34
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.7858
    • Cell wall & surface Score: 0.0367
    • Extracellular Score: 0.1773
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: FLAACGQ
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000394
    • TAT(Tat/SPI): 0.000051
    • LIPO(Sec/SPII): 0.999411
    • Cleavage Site: CS pos: 17-18. LAA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSKDVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPVARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSFKDPNANGKYSIVTVDYTGQAMVTDPNYQQ

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Lipoprotein [1] [2] [3] [4]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [5]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]